Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5VOSQE)

• DOT Name: Collagen alpha-2(V) chain (COL5A2)
• Synonyms: Collagen alpha-2(V) chain
• Gene Name: COL5A2
• Related Disease:
  Ehlers-Danlos syndrome, classic type
  OPTN-related open angle glaucoma
  Abdominal aortic aneurysm
  Acute myocardial infarction
  Autoimmune lymphoproliferative syndrome type 2B
  Bladder cancer
  Cardiovascular disease
  Coagulation defect
  Dilated cardiomyopathy 1A
  Ductal breast carcinoma in situ
  Ehlers-Danlos syndrome
  Ehlers-Danlos syndrome, classic type, 1
  Ehlers-Danlos syndrome, classic type, 2
  Gastric adenocarcinoma
  Liver cirrhosis
  Multisystemic smooth muscle dysfunction syndrome
  Myocardial infarction
  Myocardial ischemia
  Parkinson disease
  Urinary bladder cancer
  Urinary bladder neoplasm
  Gastric cancer
  Neoplasm
  Pancreatic cancer
  Stomach cancer
  Advanced cancer
  Colorectal carcinoma
  Neuroblastoma
• UniProt ID: CO5A2_HUMAN
• Pfam ID: PF01410 ; PF01391 ; PF00093
• Sequence:
  MMANWAEARPLLILIVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQ
  ICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGL
  VPVVTGIRGRPGPAGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPS
  HPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGPPG
  EPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKG
  HRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHG
  MPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPG
  AIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAG
  PKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKG
  AQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPG
  PPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG
  LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG
  EPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG
  GIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG
  PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRG
  TQGPPGATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAG
  PPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVG
  PTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPG
  SQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRG
  QKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPG
  VRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD
  KNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSV
  EDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSP
  NTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIR
  FRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCFV
• Function: Type V collagen is a member of group I collagen (fibrillar forming collagen). It is a minor connective tissue component of nearly ubiquitous distribution. Type V collagen binds to DNA, heparan sulfate, thrombospondin, heparin, and insulin. Type V collagen is a key determinant in the assembly of tissue-specific matrices.
• KEGG Pathway:
  Cytoskeleton in muscle cells (hsa04820)
  Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Extracellular matrix organization (R-HSA-1474244)
  Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
  Signaling by PDGF (R-HSA-186797)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Integrin cell surface interactions (R-HSA-216083)
  Syndecan interactions (R-HSA-3000170)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  NCAM1 interactions (R-HSA-419037)
  MET activates PTK2 signaling (R-HSA-8874081)
  Collagen chain trimerization (R-HSA-8948216)
  Collagen degradation (R-HSA-1442490)

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ehlers-Danlos syndrome, classic type	DISKOTBA	Definitive	Autosomal dominant	[1]
OPTN-related open angle glaucoma	DISDR98A	Definitive	Biomarker	[2]
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[3]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[4]
Autoimmune lymphoproliferative syndrome type 2B	DIS7EXGM	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Biomarker	[6]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[7]
Coagulation defect	DIS9X3H6	Strong	Biomarker	[5]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[8]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Altered Expression	[8]
Ehlers-Danlos syndrome	DISSVBRR	Strong	Genetic Variation	[9]
Ehlers-Danlos syndrome, classic type, 1	DIS4BR9L	Strong	Biomarker	[10]
Ehlers-Danlos syndrome, classic type, 2	DISNDKU3	Strong	Autosomal dominant	[11]
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[12]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[13]
Multisystemic smooth muscle dysfunction syndrome	DISV2K69	Strong	Biomarker	[14]
Myocardial infarction	DIS655KI	Strong	Biomarker	[7]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[7]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[15]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[6]
Gastric cancer	DISXGOUK	moderate	Biomarker	[16]
Neoplasm	DISZKGEW	moderate	Altered Expression	[6]
Pancreatic cancer	DISJC981	moderate	Biomarker	[17]
Stomach cancer	DISKIJSX	moderate	Biomarker	[16]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[18]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[19]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[20]

This DOT Affected the Drug Response of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Collagen alpha-2(V) chain (COL5A2) decreases the response to substance of Doxorubicin.	[44]
Cisplatin	DMRHGI9	Approved	Collagen alpha-2(V) chain (COL5A2) decreases the response to substance of Cisplatin.	[44]
Methotrexate	DM2TEOL	Approved	Collagen alpha-2(V) chain (COL5A2) decreases the response to substance of Methotrexate.	[44]
Fluorouracil	DMUM7HZ	Approved	Collagen alpha-2(V) chain (COL5A2) affects the response to substance of Fluorouracil.	[45]
Paclitaxel	DMLB81S	Approved	Collagen alpha-2(V) chain (COL5A2) decreases the response to substance of Paclitaxel.	[44]
Topotecan	DMP6G8T	Approved	Collagen alpha-2(V) chain (COL5A2) decreases the response to substance of Topotecan.	[44]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Collagen alpha-2(V) chain (COL5A2).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Collagen alpha-2(V) chain (COL5A2).	[38]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[22]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Collagen alpha-2(V) chain (COL5A2).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[24]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Collagen alpha-2(V) chain (COL5A2).	[25]
Triclosan	DMZUR4N	Approved	Triclosan affects the expression of Collagen alpha-2(V) chain (COL5A2).	[26]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[27]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Collagen alpha-2(V) chain (COL5A2).	[28]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Collagen alpha-2(V) chain (COL5A2).	[29]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[30]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Collagen alpha-2(V) chain (COL5A2).	[31]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[32]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Collagen alpha-2(V) chain (COL5A2).	[33]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[34]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Collagen alpha-2(V) chain (COL5A2).	[35]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[36]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[37]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Collagen alpha-2(V) chain (COL5A2).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Collagen alpha-2(V) chain (COL5A2).	[41]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Collagen alpha-2(V) chain (COL5A2).	[42]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Collagen alpha-2(V) chain (COL5A2).	[26]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Collagen alpha-2(V) chain (COL5A2).	[43]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Genetic factors influencing the reduction of central corneal thickness in disorders affecting the eye.Ophthalmic Genet. 2017 Dec;38(6):501-510. doi: 10.1080/13816810.2017.1313993. Epub 2017 Apr 28.
• [3] Deficits in Col5a2 Expression Result in Novel Skin and Adipose Abnormalities and Predisposition to Aortic Aneurysms and Dissections.Am J Pathol. 2017 Oct;187(10):2300-2311. doi: 10.1016/j.ajpath.2017.06.006. Epub 2017 Jul 19.
• [4] Identifying key genes associated with acute myocardial infarction.Medicine (Baltimore). 2017 Oct;96(42):e7741. doi: 10.1097/MD.0000000000007741.
• [5] Mutations of the alpha2(V) chain of type V collagen impair matrix assembly and produce ehlers-danlos syndrome type I.Hum Mol Genet. 1998 Feb;7(2):249-55. doi: 10.1093/hmg/7.2.249.
• [6] The clinical significance of COL5A2 in patients with bladder cancer: A retrospective analysis of bladder cancer gene expression data.Medicine (Baltimore). 2018 Mar;97(10):e0091. doi: 10.1097/MD.0000000000010091.
• [7] Analysis of a gene co-expression network establishes robust association between Col5a2 and ischemic heart disease.BMC Med Genomics. 2013 Apr 10;6:13. doi: 10.1186/1755-8794-6-13.
• [8] Gene expression profiling of tumour epithelial and stromal compartments during breast cancer progression.Breast Cancer Res Treat. 2012 Aug;135(1):153-65. doi: 10.1007/s10549-012-2123-4. Epub 2012 Jun 21.
• [9] A case of Ehlers-Danlos syndrome presenting with widened atrophic scars of forehead, elbow, knee, and pretibial area: A case report.Medicine (Baltimore). 2019 Sep;98(37):e17138. doi: 10.1097/MD.0000000000017138.
• [10] Homozygosity and Heterozygosity for Null Col5a2 Alleles Produce Embryonic Lethality and a Novel Classic Ehlers-Danlos Syndrome-Related Phenotype.Am J Pathol. 2015 Jul;185(7):2000-11. doi: 10.1016/j.ajpath.2015.03.022. Epub 2015 May 16.
• [11] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [12] Key Genes in Stomach Adenocarcinoma Identified via Network Analysis of RNA-Seq Data.Pathol Oncol Res. 2017 Oct;23(4):745-752. doi: 10.1007/s12253-016-0178-y. Epub 2017 Jan 5.
• [13] Gene Expression Patterns Associated With Histopathology in Toxic Liver Fibrosis.Toxicol Sci. 2016 Jan;149(1):67-88. doi: 10.1093/toxsci/kfv214. Epub 2015 Sep 22.
• [14] Targeted genetic analysis in a large cohort of familial and sporadic cases of aneurysm or dissection of the thoracic aorta.Genet Med. 2018 Nov;20(11):1414-1422. doi: 10.1038/gim.2018.27. Epub 2018 Mar 15.
• [15] A Pooling Genome-Wide Association Study Combining a Pathway Analysis for Typical Sporadic Parkinson's Disease in the Han Population of Chinese Mainland.Mol Neurobiol. 2016 Sep;53(7):4302-18. doi: 10.1007/s12035-015-9331-y. Epub 2015 Jul 31.
• [16] Transcriptional Regulatory Network Analysis for Gastric Cancer Based on mRNA Microarray.Pathol Oncol Res. 2017 Oct;23(4):785-791. doi: 10.1007/s12253-016-0159-1. Epub 2017 Jan 11.
• [17] Integrated transcriptomic analysis reveals hub genes involved in diagnosis and prognosis of pancreatic cancer.Mol Med. 2019 Nov 9;25(1):47. doi: 10.1186/s10020-019-0113-2.
• [18] Comparative genomic analysis of collagen gene diversity.3 Biotech. 2019 Mar;9(3):83. doi: 10.1007/s13205-019-1616-9. Epub 2019 Feb 14.
• [19] Colorectal carcinogenesis is associated with stromal expression of COL11A1 and COL5A2.Carcinogenesis. 2001 Jun;22(6):875-8. doi: 10.1093/carcin/22.6.875.
• [20] Weighted gene co-expression network analysis in identification of endometrial cancer prognosis markers.Asian Pac J Cancer Prev. 2012;13(9):4607-11. doi: 10.7314/apjcp.2012.13.9.4607.
• [21] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [22] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [23] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [24] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [25] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [26] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [27] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [28] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [29] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [30] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [31] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [32] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [33] Use of transcriptomics in hazard identification and next generation risk assessment: A case study with clothianidin. Food Chem Toxicol. 2022 Aug;166:113212. doi: 10.1016/j.fct.2022.113212. Epub 2022 Jun 8.
• [34] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [35] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [36] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [37] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [38] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [39] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [40] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [42] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [43] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [44] Microarray-based detection and expression analysis of extracellular matrix proteins in drug?resistant ovarian cancer cell lines. Oncol Rep. 2014 Nov;32(5):1981-90. doi: 10.3892/or.2014.3468. Epub 2014 Sep 9.
• [45] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.