Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT626PBA)

• DOT Name: Fermitin family homolog 1 (FERMT1)
• Synonyms: Kindlerin; Kindlin syndrome protein; Kindlin-1; Unc-112-related protein 1
• Gene Name: FERMT1
• Related Disease:
  Kindler syndrome
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Carcinoma of esophagus
  Colitis
  Colon adenoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Epidermolysis bullosa
  Esophageal cancer
  Hepatocellular carcinoma
  Inflammatory bowel disease
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Neoplasm
  Neoplasm of esophagus
  Pancreatic cancer
  Photosensitivity disease
  Skin cancer
  Skin disease
  Squamous cell carcinoma
  Ulcerative colitis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Neuralgia
  Bone osteosarcoma
  Crohn disease
  Kaposi sarcoma
  Osteosarcoma
  Type-1/2 diabetes
• UniProt ID: FERM1_HUMAN
• Pfam ID: PF00373 ; PF18124 ; PF00169
• Sequence:
  MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
  LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
  VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSP
  GLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSL
  VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
  LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKAD
  SLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL
  RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADS
  SYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKRHKSKQLAARILEAH
  QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIP
  VTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
  NETLDEDLFHKLTGGQD
• Function: Involved in cell adhesion. Contributes to integrin activation. When coexpressed with talin, potentiates activation of ITGA2B. Required for normal keratinocyte proliferation. Required for normal polarization of basal keratinocytes in skin, and for normal cell shape. Required for normal adhesion of keratinocytes to fibronectin and laminin, and for normal keratinocyte migration to wound sites. May mediate TGF-beta 1 signaling in tumor progression.
• Tissue Specificity: Expressed in brain, skeletal muscle, kidney, colon, adrenal gland, prostate, and placenta. Weakly or not expressed in heart, thymus, spleen, liver, small intestine, bone marrow, lung and peripheral blood leukocytes. Overexpressed in some colon and lung tumors. In skin, it is localized within the epidermis and particularly in basal keratocytes. Not detected in epidermal melanocytes and dermal fibroblasts.

Molecular Interaction Atlas (MIA) of This DOT

38 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Kindler syndrome	DIS8AP9J	Definitive	Autosomal recessive	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[3]
Carcinoma	DISH9F1N	Strong	Altered Expression	[4]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[5]
Colitis	DISAF7DD	Strong	Biomarker	[6]
Colon adenoma	DISPMZ3U	Strong	Altered Expression	[7]
Colon cancer	DISVC52G	Strong	Altered Expression	[8]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[8]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[9]
Epidermolysis bullosa	DISVOTZQ	Strong	Genetic Variation	[10]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[11]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[12]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[3]
Lung cancer	DISCM4YA	Strong	Altered Expression	[3]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[3]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Altered Expression	[5]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[5]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[13]
Photosensitivity disease	DISTB3ML	Strong	Genetic Variation	[14]
Skin cancer	DISTM18U	Strong	Biomarker	[15]
Skin disease	DISDW8R6	Strong	Genetic Variation	[16]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[17]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[18]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[3]
Neuralgia	DISWO58J	moderate	Altered Expression	[19]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[20]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[12]
Kaposi sarcoma	DISC1H1Z	Limited	Genetic Variation	[21]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[20]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[22]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Fermitin family homolog 1 (FERMT1) decreases the response to substance of Arsenic trioxide.	[44]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Fermitin family homolog 1 (FERMT1).	[23]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fermitin family homolog 1 (FERMT1).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Fermitin family homolog 1 (FERMT1).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Fermitin family homolog 1 (FERMT1).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Fermitin family homolog 1 (FERMT1).	[27]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Fermitin family homolog 1 (FERMT1).	[28]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Fermitin family homolog 1 (FERMT1).	[29]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Fermitin family homolog 1 (FERMT1).	[30]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Fermitin family homolog 1 (FERMT1).	[31]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Fermitin family homolog 1 (FERMT1).	[32]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Fermitin family homolog 1 (FERMT1).	[33]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Fermitin family homolog 1 (FERMT1).	[34]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Fermitin family homolog 1 (FERMT1).	[35]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Fermitin family homolog 1 (FERMT1).	[34]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Fermitin family homolog 1 (FERMT1).	[31]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Fermitin family homolog 1 (FERMT1).	[37]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Fermitin family homolog 1 (FERMT1).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Fermitin family homolog 1 (FERMT1).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Fermitin family homolog 1 (FERMT1).	[41]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Fermitin family homolog 1 (FERMT1).	[42]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Fermitin family homolog 1 (FERMT1).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Fermitin family homolog 1 (FERMT1).	[36]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Fermitin family homolog 1 (FERMT1).	[39]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Kindlin-1 Promotes Pulmonary Breast Cancer Metastasis.Cancer Res. 2018 Mar 15;78(6):1484-1496. doi: 10.1158/0008-5472.CAN-17-1518. Epub 2018 Jan 12.
• [3] Role of the focal adhesion protein kindlin-1 in breast cancer growth and lung metastasis.J Natl Cancer Inst. 2011 Sep 7;103(17):1323-37. doi: 10.1093/jnci/djr290. Epub 2011 Aug 10.
• [4] URP1: a member of a novel family of PH and FERM domain-containing membrane-associated proteins is significantly over-expressed in lung and colon carcinomas.Biochim Biophys Acta. 2003 Apr 17;1637(3):207-16. doi: 10.1016/s0925-4439(03)00035-8.
• [5] The Effect of FERMT1 Regulated by miR-24 on the Growth and Radiation Resistance of Esophageal Cancer.J Biomed Nanotechnol. 2019 Mar 1;15(3):621-631. doi: 10.1166/jbn.2019.2711.
• [6] Chronic colitis due to an epithelial barrier defect: the role of kindlin-1 isoforms.J Pathol. 2007 Dec;213(4):462-70. doi: 10.1002/path.2253.
• [7] Digital transcript profile analysis with aRNA-LongSAGE validates FERMT1 as a potential novel prognostic marker for colon cancer.Clin Cancer Res. 2011 May 1;17(9):2908-18. doi: 10.1158/1078-0432.CCR-10-2552. Epub 2011 Jan 10.
• [8] FERMT1 mediates epithelial-mesenchymal transition to promote colon cancer metastasis via modulation of -catenin transcriptional activity.Oncogene. 2017 Mar 30;36(13):1779-1792. doi: 10.1038/onc.2016.339. Epub 2016 Sep 19.
• [9] Focal adhesion molecule Kindlin-1 mediates activation of TGF- signaling by interacting with TGF-RI, SARA and Smad3 in colorectal cancer cells.Oncotarget. 2016 Nov 15;7(46):76224-76237. doi: 10.18632/oncotarget.12779.
• [10] Focal adhesions in the skin: lessons learned from skin fragility disorders.Eur J Dermatol. 2017 Jun 1;27(S1):8-11. doi: 10.1684/ejd.2017.3039.
• [11] Expression of Kindlin-1 in human hepatocellular carcinoma and its prognostic significance.Tumour Biol. 2015 Jun;36(6):4235-41. doi: 10.1007/s13277-015-3060-8. Epub 2015 Jan 16.
• [12] Genome-wide association study implicates immune activation of multiple integrin genes in inflammatory bowel disease.Nat Genet. 2017 Feb;49(2):256-261. doi: 10.1038/ng.3760. Epub 2017 Jan 9.
• [13] Kindlin-1 expression is involved in migration and invasion of pancreatic cancer.Int J Oncol. 2013 Apr;42(4):1360-6. doi: 10.3892/ijo.2013.1838. Epub 2013 Feb 22.
• [14] Recurrent mutations in kindlin-1, a novel keratinocyte focal contact protein, in the autosomal recessive skin fragility and photosensitivity disorder, Kindler syndrome.J Invest Dermatol. 2004 Jan;122(1):78-83. doi: 10.1046/j.0022-202X.2003.22136.x.
• [15] FERMT1 promoter mutations in patients with Kindler syndrome.Clin Genet. 2015 Sep;88(3):248-54. doi: 10.1111/cge.12490. Epub 2014 Oct 7.
• [16] Kindlin-1 protects cells from oxidative damage through activation of ERK signalling.Free Radic Biol Med. 2017 Jul;108:896-903. doi: 10.1016/j.freeradbiomed.2017.05.013. Epub 2017 May 10.
• [17] KIND1 Loss Sensitizes Keratinocytes to UV-Induced Inflammatory Response and DNA Damage.J Invest Dermatol. 2017 Feb;137(2):475-483. doi: 10.1016/j.jid.2016.09.023. Epub 2016 Oct 7.
• [18] Loss of Kindlin-1 causes skin atrophy and lethal neonatal intestinal epithelial dysfunction.PLoS Genet. 2008 Dec;4(12):e1000289. doi: 10.1371/journal.pgen.1000289. Epub 2008 Dec 5.
• [19] Kindlin-1 Regulates Astrocyte Activation and Pain Sensitivity in Rats With Neuropathic Pain.Reg Anesth Pain Med. 2018 Jul;43(5):547-553. doi: 10.1097/AAP.0000000000000780.
• [20] Prognostic implications of Kindlin proteins in human osteosarcoma.Onco Targets Ther. 2017 Feb 7;10:657-665. doi: 10.2147/OTT.S125418. eCollection 2017.
• [21] A novel large deletion mutation of FERMT1 gene in a Chinese patient with Kindler syndrome.J Zhejiang Univ Sci B. 2015 Nov;16(11):957-62. doi: 10.1631/jzus.B1500080.
• [22] Evaluating KIND1 human embryonic stem cell-derived pancreatic progenitors to ameliorate streptozotocin-induced diabetes in mice.Indian J Med Res. 2017 Aug;146(2):244-254. doi: 10.4103/ijmr.IJMR_210_16.
• [23] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [24] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [25] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [26] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [29] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [30] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [31] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [32] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [33] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [36] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [37] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [38] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [39] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [40] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [42] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [43] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [44] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.