Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7G55IK)

• DOT Name: Serpin B6 (SERPINB6)
• Synonyms: Cytoplasmic antiproteinase; CAP; Peptidase inhibitor 6; PI-6; Placental thrombin inhibitor
• Gene Name: SERPINB6
• Related Disease:
  Non-insulin dependent diabetes
  Small lymphocytic lymphoma
  Tuberculosis
  Acute leukaemia
  Alzheimer disease
  Amyloidosis
  Arrhythmia
  Autosomal recessive nonsyndromic hearing loss 91
  Bacteremia
  Beta thalassemia
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cerebral infarction
  Chromosomal disorder
  Colitis
  Deafness
  Epilepsy
  Fatty liver disease
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Huntington disease
  Mantle cell lymphoma
  Neoplasm
  Non-alcoholic fatty liver disease
  Perry syndrome
  Pneumonia
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Sensorineural hearing loss disorder
  Thalassemia
  Type-1/2 diabetes
  Adult glioblastoma
  Glioblastoma multiforme
  Influenza
  Invasive breast carcinoma
  Methicillin-resistant staphylococci infection
  Nonsyndromic genetic hearing loss
  Hearing loss, autosomal recessive
  Aplastic anemia
  Epithelial ovarian cancer
  Advanced cancer
  Asthma
  Bone osteosarcoma
  Gastric cancer
  Lewy body dementia
  Osteosarcoma
  Stomach cancer
• UniProt ID: SPB6_HUMAN
• Pfam ID: PF00079
• Sequence:
  MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFN
  KSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEE
  LDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKE
  NTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTD
  LRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
  DFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCADHPFLFFIQ
  HSKTNGILFCGRFSSP
• Function: May be involved in the regulation of serine proteinases present in the brain or extravasated from the blood. Inhibitor of cathepsin G, kallikrein-8 and thrombin. May play an important role in the inner ear in the protection against leakage of lysosomal content during stress and loss of this protection results in cell death and sensorineural hearing loss.
• Tissue Specificity: Expressed in keratinocytes (at protein level). Highest levels in skeletal muscle. Also found in placenta, cardiac muscle, lung, liver, kidney and pancreas. Expressed in the inner ear hair cells. Expressed abundantly by normal mast cells in different tissues and by mast cells in mastocytoma lesions.
• KEGG Pathway: Amoebiasis (hsa05146)
• Reactome Pathway:
  Dissolution of Fibrin Clot (R-HSA-75205)
  Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[1]
Small lymphocytic lymphoma	DIS30POX	Definitive	Genetic Variation	[2]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[3]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Amyloidosis	DISHTAI2	Strong	Altered Expression	[6]
Arrhythmia	DISFF2NI	Strong	Genetic Variation	[7]
Autosomal recessive nonsyndromic hearing loss 91	DISMI1WE	Strong	Autosomal recessive	[8]
Bacteremia	DIS6N9RZ	Strong	Genetic Variation	[9]
Beta thalassemia	DIS5RCQK	Strong	Genetic Variation	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[12]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[13]
Cerebral infarction	DISR1WNP	Strong	Biomarker	[14]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[15]
Colitis	DISAF7DD	Strong	Genetic Variation	[16]
Deafness	DISKCLH4	Strong	Biomarker	[17]
Epilepsy	DISBB28L	Strong	Biomarker	[18]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[19]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[20]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[21]
Huntington disease	DISQPLA4	Strong	Biomarker	[22]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[23]
Neoplasm	DISZKGEW	Strong	Biomarker	[24]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[25]
Perry syndrome	DIS8YKKM	Strong	Genetic Variation	[26]
Pneumonia	DIS8EF3M	Strong	Biomarker	[27]
Prostate cancer	DISF190Y	Strong	Biomarker	[28]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[28]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[29]
Sensorineural hearing loss disorder	DISJV45Z	Strong	Biomarker	[30]
Thalassemia	DIS76XZB	Strong	Genetic Variation	[31]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[32]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[33]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[33]
Influenza	DIS3PNU3	moderate	Biomarker	[34]
Invasive breast carcinoma	DISANYTW	moderate	Biomarker	[35]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[36]
Nonsyndromic genetic hearing loss	DISZX61P	Moderate	Autosomal recessive	[37]
Hearing loss, autosomal recessive	DIS8G9R9	Supportive	Autosomal recessive	[38]
Aplastic anemia	DISJRSC0	Disputed	Biomarker	[39]
Epithelial ovarian cancer	DIS56MH2	Disputed	Genetic Variation	[40]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[41]
Asthma	DISW9QNS	Limited	Biomarker	[42]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[43]
Gastric cancer	DISXGOUK	Limited	Genetic Variation	[44]
Lewy body dementia	DISAE66J	Limited	Biomarker	[45]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[43]
Stomach cancer	DISKIJSX	Limited	Genetic Variation	[44]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Serpin B6 (SERPINB6).	[46]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Serpin B6 (SERPINB6).	[47]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Serpin B6 (SERPINB6).	[48]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Serpin B6 (SERPINB6).	[49]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Serpin B6 (SERPINB6).	[50]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Serpin B6 (SERPINB6).	[51]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Serpin B6 (SERPINB6).	[52]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Serpin B6 (SERPINB6).	[53]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Serpin B6 (SERPINB6).	[54]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Serpin B6 (SERPINB6).	[55]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Serpin B6 (SERPINB6).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Serpin B6 (SERPINB6).	[58]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Serpin B6 (SERPINB6).	[56]

References

• [1] Capsaicin reduces Alzheimer-associated tau changes in the hippocampus of type 2 diabetes rats.PLoS One. 2017 Feb 22;12(2):e0172477. doi: 10.1371/journal.pone.0172477. eCollection 2017.
• [2] Meta-analysis of genome-wide association studies discovers multiple loci for chronic lymphocytic leukemia.Nat Commun. 2016 Mar 9;7:10933. doi: 10.1038/ncomms10933.
• [3] Diagnostic accuracy study of multiplex PCR for detecting tuberculosis drug resistance.J Infect. 2015 Aug;71(2):220-30. doi: 10.1016/j.jinf.2015.03.011. Epub 2015 Apr 30.
• [4] Risk factors and coping strategies of severe community-acquired pneumonia in chemotherapy induction period of acute leukemia.Oncol Lett. 2018 Mar;15(3):3566-3571. doi: 10.3892/ol.2018.7731. Epub 2018 Jan 4.
• [5] PTI-125 binds and reverses an altered conformation of filamin A to reduce Alzheimer's disease pathogenesis.Neurobiol Aging. 2017 Jul;55:99-114. doi: 10.1016/j.neurobiolaging.2017.03.016. Epub 2017 Mar 31.
• [6] Sex-specific genetic predictors of Alzheimer's disease biomarkers.Acta Neuropathol. 2018 Dec;136(6):857-872. doi: 10.1007/s00401-018-1881-4. Epub 2018 Jul 2.
• [7] Quality of life benefits from arrhythmia ablation: A longitudinal study using the C-CAP questionnaire and EQ5D.Pacing Clin Electrophysiol. 2019 Jun;42(6):705-711. doi: 10.1111/pace.13675. Epub 2019 Apr 17.
• [8] A truncating mutation in SERPINB6 is associated with autosomal-recessive nonsyndromic sensorineural hearing loss. Am J Hum Genet. 2010 May 14;86(5):797-804. doi: 10.1016/j.ajhg.2010.04.004. Epub 2010 May 6.
• [9] The efficacy and safety of tigecycline for the treatment of bloodstream infections: a systematic review and meta-analysis.Ann Clin Microbiol Antimicrob. 2017 Apr 5;16(1):24. doi: 10.1186/s12941-017-0199-8.
• [10] A beta-thalassaemia phenotype not linked to the beta-globin cluster in an Italian family.Br J Haematol. 1992 Jun;81(2):283-7. doi: 10.1111/j.1365-2141.1992.tb08221.x.
• [11] Assessment of ERBB2/HER2 Status in HER2-Equivocal Breast Cancers by FISH and 2013/2014 ASCO-CAP Guidelines.JAMA Oncol. 2019 Mar 1;5(3):366-375. doi: 10.1001/jamaoncol.2018.6012.
• [12] What to expect from the 2018 ASCO/CAP HER2 guideline in the reflex in situ hybridization test of immunohistochemically equivocal 2+ cases?.Virchows Arch. 2019 Sep;475(3):303-311. doi: 10.1007/s00428-019-02567-z. Epub 2019 Apr 5.
• [13] Antineoplastic effect of pectic polysaccharides from green sweet pepper (Capsicum annuum) on mammary tumor cells in vivo and in vitro.Carbohydr Polym. 2018 Dec 1;201:280-292. doi: 10.1016/j.carbpol.2018.08.071. Epub 2018 Aug 20.
• [14] Targeted disruption of SPI3/Serpinb6 does not result in developmental or growth defects, leukocyte dysfunction, or susceptibility to stroke.Mol Cell Biol. 2004 May;24(9):4075-82. doi: 10.1128/MCB.24.9.4075-4082.2004.
• [15] LS-CAP: an algorithm for identifying cytogenetic aberrations in hepatocellular carcinoma using microarray data.Front Biosci. 2006 May 1;11:1311-22. doi: 10.2741/1885.
• [16] In situ self-spray coating system that can uniformly disperse a poorly water-soluble H(2)S donor on the colorectal surface to treat inflammatory bowel diseases.Biomaterials. 2018 Nov;182:289-298. doi: 10.1016/j.biomaterials.2018.07.044. Epub 2018 Aug 16.
• [17] A novel serpin-like protein, B-43, exists in both neurons and astrocytes: an immunohistochemical study in the parietal region of the bovine brain.Neurosci Lett. 1995 Nov 17;200(2):125-8. doi: 10.1016/0304-3940(95)12095-l.
• [18] Earlyonset epilepsy and microcephalycapillary malformation syndrome caused by a novel STAMBP mutation in a Chinese boy.Mol Med Rep. 2019 Dec;20(6):5145-5151. doi: 10.3892/mmr.2019.10757. Epub 2019 Oct 17.
• [19] Effect of Non-alcoholic Fatty Liver Disease on Transaminase Levels and Transient Elastography in Patients with Chronic Hepatitis B.Cureus. 2019 Oct 25;11(10):e5995. doi: 10.7759/cureus.5995.
• [20] Development of a new duplex real-time polymerase chain reaction assay for hepatitis B viral DNA detection.Virol J. 2011 May 14;8:227. doi: 10.1186/1743-422X-8-227.
• [21] Production and evaluation of chicken egg-yolk-derived antibodies against Campylobacter jejuni colonization-associated proteins.Foodborne Pathog Dis. 2013 Jul;10(7):624-31. doi: 10.1089/fpd.2012.1313. Epub 2013 Jun 6.
• [22] Indexing disease progression at study entry with individuals at-risk for Huntington disease.Am J Med Genet B Neuropsychiatr Genet. 2011 Dec;156B(7):751-63. doi: 10.1002/ajmg.b.31232. Epub 2011 Aug 19.
• [23] Frontline bortezomib, rituximab, cyclophosphamide, doxorubicin, and prednisone (VR-CAP) versus rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) in transplantation-ineligible patients with newly diagnosed mantle cell lymphoma: final overall survival results of a randomised, open-label, phase 3 study.Lancet Oncol. 2018 Nov;19(11):1449-1458. doi: 10.1016/S1470-2045(18)30685-5. Epub 2018 Oct 19.
• [24] Assessing the impact of the 2018 American Society of Clinical Oncology/College of American Pathologists recommendations on human epidermal growth factor receptor 2 testing by fluorescence in situ hybridization in breast carcinoma.Virchows Arch. 2020 Mar;476(3):367-372. doi: 10.1007/s00428-019-02636-3. Epub 2019 Aug 3.
• [25] Optimal threshold of controlled attenuation parameter with MRI-PDFF as the gold standard for the detection of hepatic steatosis.Hepatology. 2018 Apr;67(4):1348-1359. doi: 10.1002/hep.29639. Epub 2018 Feb 19.
• [26] Disease-associated mutations in the p150(Glued) subunit destabilize the CAP-gly domain.Biochemistry. 2010 Jun 29;49(25):5083-5. doi: 10.1021/bi100235z.
• [27] A case-control study of community-acquired Acinetobacter baumannii pneumonia and melioidosis pneumonia in northeast Thailand: an emerging fatal disease with unique clinical features.Diagn Microbiol Infect Dis. 2017 Jan;87(1):79-86. doi: 10.1016/j.diagmicrobio.2016.10.014. Epub 2016 Oct 11.
• [28] Urinary biomarkers in prostate cancer detection and monitoring progression.Crit Rev Oncol Hematol. 2017 Oct;118:15-26. doi: 10.1016/j.critrevonc.2017.08.002. Epub 2017 Aug 19.
• [29] Comparative RNA-seq analysis reveals dys-regulation of major canonical pathways in ERG-inducible LNCaP cell progression model of prostate cancer.Oncotarget. 2019 Jul 2;10(42):4290-4306. doi: 10.18632/oncotarget.27019. eCollection 2019 Jul 2.
• [30] Subtelomeric 6p25 deletion/duplication: Report of a patient with new clinical findings and genotype-phenotype correlations.Eur J Med Genet. 2015 May;58(5):310-8. doi: 10.1016/j.ejmg.2015.02.011. Epub 2015 Mar 24.
• [31] Borderline hemoglobin A(2) levels in northern Thai population: HBB genotypes and effects of coinherited alpha-thalassemia.Blood Cells Mol Dis. 2019 Feb;74:13-17. doi: 10.1016/j.bcmd.2018.10.002. Epub 2018 Oct 4.
• [32] Liver fibrosis by FibroScan() independently of established cardiovascular risk parameters associates with macrovascular and microvascular complications in patients with type 2 diabetes.Liver Int. 2020 Feb;40(2):347-354. doi: 10.1111/liv.14274. Epub 2019 Oct 31.
• [33] A Novel Micro Cold Atmospheric Plasma Device for Glioblastoma Both In Vitro and In Vivo.Cancers (Basel). 2017 May 30;9(6):61. doi: 10.3390/cancers9060061.
• [34] DMO-CAP inhibits influenza virus replication by activating heme oxygenase-1-mediated IFN response.Virol J. 2019 Feb 20;16(1):21. doi: 10.1186/s12985-019-1125-9.
• [35] Assessment of dual-probe Her-2 fluorescent in situ hybridization in breast cancer by the 2013 ASCO/CAP guidelines produces more equivocal results than that by the 2007 ASCO/CAP guidelines.Breast Cancer Res Treat. 2016 Aug;159(1):31-9. doi: 10.1007/s10549-016-3917-6. Epub 2016 Jul 25.
• [36] Healthcare- and Community-Associated Methicillin-Resistant Staphylococcus aureus (MRSA) and Fatal Pneumonia with Pediatric Deaths in Krasnoyarsk, Siberian Russia: Unique MRSA's Multiple Virulence Factors, Genome, and Stepwise Evolution.PLoS One. 2015 Jun 5;10(6):e0128017. doi: 10.1371/journal.pone.0128017. eCollection 2015.
• [37] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [38] [Gene therapy for human hearing loss: challenges and promises]. Med Sci (Paris). 2013 Oct;29(10):883-9. doi: 10.1051/medsci/20132910016. Epub 2013 Oct 18.
• [39] A new genetic polymorphism in the 16S ribosomal RNA gene of human mitochondrial DNA.Ann Hum Genet. 1989 Oct;53(4):303-10. doi: 10.1111/j.1469-1809.1989.tb01799.x.
• [40] Assessing the HER2 status in mucinous epithelial ovarian cancer on the basis of the 2013 ASCO/CAP guideline update.Am J Surg Pathol. 2014 Sep;38(9):1227-34. doi: 10.1097/PAS.0000000000000268.
• [41] Multi-Institutional Evaluation of Interrater Agreement of Variant Classification Based on the 2017 Association for Molecular Pathology, American Society of Clinical Oncology, and College of American Pathologists Standards and Guidelines for the Interpretation and Reporting of Sequence Variants in Cancer.J Mol Diagn. 2020 Feb;22(2):284-293. doi: 10.1016/j.jmoldx.2019.10.010. Epub 2019 Dec 16.
• [42] Pseudotyped adeno-associated virus 2/9-delivered CCL11 shRNA alleviates lung inflammation in an allergen-sensitized mouse model.Hum Gene Ther. 2012 Nov;23(11):1156-65. doi: 10.1089/hum.2012.012. Epub 2012 Oct 19.
• [43] Inhibition of STAT3 blocks protein synthesis and tumor metastasis in osteosarcoma cells.J Exp Clin Cancer Res. 2018 Oct 4;37(1):244. doi: 10.1186/s13046-018-0914-0.
• [44] A novel scoring system for gastric cancer risk assessment based on the expression of three CLIP4 DNA methylation-associated genes.Int J Oncol. 2018 Aug;53(2):633-643. doi: 10.3892/ijo.2018.4433. Epub 2018 Jun 6.
• [45] Differences in responses to the Rorschach test between patients with dementia with Lewy bodies and Alzheimer's disease -from the perspective of visuoperceptual impairment.Psychiatry Res. 2017 Nov;257:456-461. doi: 10.1016/j.psychres.2017.08.038. Epub 2017 Aug 18.
• [46] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [47] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [48] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [49] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [50] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [51] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [52] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [53] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [54] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [55] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [56] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [57] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [58] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.