Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7SAQT2)

• DOT Name: Secretogranin-1 (CHGB)
• Synonyms: Chromogranin-B; CgB; Secretogranin I; SgI
• Gene Name: CHGB
• Related Disease:
  Myelodysplastic syndrome
  Neoplasm
  Alzheimer disease
  Aortic valve stenosis
  B-cell lymphoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Burkitt lymphoma
  Cardiac failure
  Cardiovascular disease
  Childhood myelodysplastic syndrome
  Congestive heart failure
  Creutzfeldt Jacob disease
  Follicular lymphoma
  High blood pressure
  Hydatidiform mole
  leukaemia
  Leukemia
  Matthew-Wood syndrome
  Multiple sclerosis
  Ovarian cancer
  Ovarian neoplasm
  Pancreas disorder
  Pancreatic neuroendocrine tumor
  Paraganglioma
  Pheochromocytoma
  Pituitary gland disorder
  Testicular cancer
  Triple negative breast cancer
  Tuberculosis
  Acute myelogenous leukaemia
  Bladder cancer
  Choriocarcinoma
  Primitive neuroectodermal tumor
  Schizophrenia
  Urinary bladder cancer
  Urinary bladder neoplasm
  Neuroendocrine neoplasm
  Acute respiratory failure
  Advanced cancer
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  Mood disorder
  Neuroblastoma
  Psychotic disorder
• UniProt ID: SCG1_HUMAN
• Pfam ID: PF01271
• Sequence:
  MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQV
  LKTSRKDVKDKETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADT
  EKWAEGGGHSRERADEPQWSLYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGE
  DSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHSQEKTHSREKSSQESG
  EETGSQENHPQESKGQPRSQEESEEGEEDATSEVDKRRTRPRHHHGRSRPDRSSQGGSLP
  SEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWE
  RYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHR
  GRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAP
  GKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRD
  NMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQ
  YDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLA
  AMDLELQKIAEKFSQRG
• Function: Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
• Tissue Specificity: Detected in cerebrospinal fluid and urine (at protein level) . Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
• Reactome Pathway:
  Post-translational protein phosphorylation (R-HSA-8957275)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Myelodysplastic syndrome	DISYHNUI	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Aortic valve stenosis	DISW7AQ9	Strong	Altered Expression	[4]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[7]
Burkitt lymphoma	DIS9D5XU	Strong	Altered Expression	[5]
Cardiac failure	DISDC067	Strong	Altered Expression	[4]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[8]
Childhood myelodysplastic syndrome	DISMN80I	Strong	Biomarker	[1]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[4]
Creutzfeldt Jacob disease	DISCB6RX	Strong	Biomarker	[3]
Follicular lymphoma	DISVEUR6	Strong	Altered Expression	[5]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[9]
Hydatidiform mole	DISKNP7O	Strong	Altered Expression	[10]
leukaemia	DISS7D1V	Strong	Biomarker	[11]
Leukemia	DISNAKFL	Strong	Biomarker	[11]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[12]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[13]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[14]
Ovarian neoplasm	DISEAFTY	Strong	Posttranslational Modification	[15]
Pancreas disorder	DISDH7NI	Strong	Biomarker	[2]
Pancreatic neuroendocrine tumor	DISDMPU0	Strong	Altered Expression	[2]
Paraganglioma	DIS2XXH5	Strong	Biomarker	[16]
Pheochromocytoma	DIS56IFV	Strong	Biomarker	[16]
Pituitary gland disorder	DIS7XB48	Strong	Biomarker	[17]
Testicular cancer	DIS6HNYO	Strong	Altered Expression	[18]
Triple negative breast cancer	DISAMG6N	Strong	Genetic Variation	[19]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[20]
Acute myelogenous leukaemia	DISCSPTN	moderate	Biomarker	[1]
Bladder cancer	DISUHNM0	moderate	Genetic Variation	[21]
Choriocarcinoma	DISDBVNL	moderate	Biomarker	[22]
Primitive neuroectodermal tumor	DISFHXHA	moderate	Altered Expression	[23]
Schizophrenia	DISSRV2N	moderate	Genetic Variation	[24]
Urinary bladder cancer	DISDV4T7	moderate	Genetic Variation	[21]
Urinary bladder neoplasm	DIS7HACE	moderate	Genetic Variation	[21]
Neuroendocrine neoplasm	DISNPLOO	Disputed	Biomarker	[2]
Acute respiratory failure	DIS5KQ5Y	Limited	Altered Expression	[25]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[14]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[26]
Mood disorder	DISLVMWO	Limited	Biomarker	[27]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[28]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[27]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Reserpine	DM6VM38	Approved	Secretogranin-1 (CHGB) increases the Metabolic disorder ADR of Reserpine.	[38]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Secretogranin-1 (CHGB).	[29]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Secretogranin-1 (CHGB).	[30]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Secretogranin-1 (CHGB).	[31]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Secretogranin-1 (CHGB).	[32]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Secretogranin-1 (CHGB).	[33]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Secretogranin-1 (CHGB).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Secretogranin-1 (CHGB).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Secretogranin-1 (CHGB).	[37]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Secretogranin-1 (CHGB).	[35]

References

• [1] Guadecitabine (SGI-110): an investigational drug for the treatment of myelodysplastic syndrome and acute myeloid leukemia.Expert Opin Investig Drugs. 2019 Oct;28(10):835-849. doi: 10.1080/13543784.2019.1667331. Epub 2019 Sep 19.
• [2] Utility of chromogranin B compared with chromogranin A as a biomarker in Japanese patients with pancreatic neuroendocrine tumors.Jpn J Clin Oncol. 2017 Jun 1;47(6):520-528. doi: 10.1093/jjco/hyx032.
• [3] Different chromogranin immunoreactivity between prion and a-beta amyloid plaque.Neuroreport. 2003 Apr 15;14(5):755-8. doi: 10.1097/00001756-200304150-00019.
• [4] Regulation of circulating chromogranin B levels in heart failure.Biomarkers. 2018 Feb;23(1):78-87. doi: 10.1080/1354750X.2017.1395079. Epub 2017 Nov 7.
• [5] Dysregulated expressions of PTEN, NF-B, WWP2, p53 and c-Myc in different subtypes of B cell lymphoma and reactive follicular hyperplasia.Am J Transl Res. 2019 Feb 15;11(2):1092-1101. eCollection 2019.
• [6] Expression of PEA3/E1AF/ETV4, an Ets-related transcription factor, in breast tumors: positive links to MMP2, NRG1 and CGB expression.Carcinogenesis. 2004 Mar;25(3):405-11. doi: 10.1093/carcin/bgh024. Epub 2003 Nov 21.
• [7] Analysis of the human CGB/LHB gene cluster in breast tumors by real-time quantitative RT-PCR assays.Cancer Lett. 2001 Jul 10;168(1):93-100. doi: 10.1016/s0304-3835(01)00496-7.
• [8] Common functional genetic variants in catecholamine storage vesicle protein promoter motifs interact to trigger systemic hypertension.J Am Coll Cardiol. 2010 Apr 6;55(14):1463-75. doi: 10.1016/j.jacc.2009.11.064.
• [9] Genetic variation within adrenergic pathways determines in vivo effects of presynaptic stimulation in humans.Circulation. 2008 Jan 29;117(4):517-25. doi: 10.1161/CIRCULATIONAHA.107.706317. Epub 2008 Jan 7.
• [10] Fine-scale quantification of HCG beta gene transcription in human trophoblastic and non-malignant non-trophoblastic tissues.Mol Hum Reprod. 2008 Jan;14(1):23-31. doi: 10.1093/molehr/gam082. Epub 2007 Nov 29.
• [11] Transcription and translation are primary targets of Pim kinase inhibitor SGI-1776 in mantle cell lymphoma.Blood. 2012 Oct 25;120(17):3491-500. doi: 10.1182/blood-2012-02-412643. Epub 2012 Sep 6.
• [12] A novel epigenetic modulating agent sensitizes pancreatic cells to a chemotherapy agent.PLoS One. 2018 Jun 21;13(6):e0199130. doi: 10.1371/journal.pone.0199130. eCollection 2018.
• [13] Quantitative proteomics suggests decrease in the secretogranin-1 cerebrospinal fluid levels during the disease course of multiple sclerosis.Proteomics. 2015 Oct;15(19):3361-9. doi: 10.1002/pmic.201400142. Epub 2015 Sep 8.
• [14] Regulation of human chorionic gonadotropin beta subunit expression in ovarian cancer.BMC Cancer. 2019 Jul 30;19(1):746. doi: 10.1186/s12885-019-5960-2.
• [15] The novel, small-molecule DNA methylation inhibitor SGI-110 as an ovarian cancer chemosensitizer.Clin Cancer Res. 2014 Dec 15;20(24):6504-16. doi: 10.1158/1078-0432.CCR-14-1553. Epub 2014 Oct 14.
• [16] Molecular Profiling of Pheochromocytoma and Abdominal Paraganglioma Stratified by the PASS Algorithm Reveals Chromogranin B as Associated With Histologic Prediction of Malignant Behavior.Am J Surg Pathol. 2019 Mar;43(3):409-421. doi: 10.1097/PAS.0000000000001190.
• [17] Co-expression network analysis of differentially expressed genes associated with metastasis in prolactin pituitary tumors.Mol Med Rep. 2014 Jul;10(1):113-8. doi: 10.3892/mmr.2014.2152. Epub 2014 Apr 15.
• [18] Immunomodulatory action of the DNA methyltransferase inhibitor SGI-110 in epithelial ovarian cancer cells and xenografts. Epigenetics. 2015;10(3):237-46.
• [19] Epigenetic reprogramming of epithelial mesenchymal transition in triple negative breast cancer cells with DNA methyltransferase and histone deacetylase inhibitors.J Exp Clin Cancer Res. 2018 Dec 14;37(1):314. doi: 10.1186/s13046-018-0988-8.
• [20] A snapshot of the predominant single nucleotide polymorphism cluster groups of Mycobacterium tuberculosis clinical isolates in Delhi, India.Tuberculosis (Edinb). 2016 Sep;100:72-81. doi: 10.1016/j.tube.2016.07.007. Epub 2016 Jul 25.
• [21] SPIRE - combining SGI-110 with cisplatin and gemcitabine chemotherapy for solid malignancies including bladder cancer: study protocol for a phase Ib/randomised IIa open label clinical trial.Trials. 2018 Apr 3;19(1):216. doi: 10.1186/s13063-018-2586-7.
• [22] Gene expression-based classification of nonseminomatous male germ cell tumors.Oncogene. 2005 Jul 28;24(32):5101-7. doi: 10.1038/sj.onc.1208694.
• [23] Altered PTEN, ATRX, CHGA, CHGB, and TP53 expression are associated with aggressive VHL-associated pancreatic neuroendocrine tumors.Horm Cancer. 2013 Jun;4(3):165-75. doi: 10.1007/s12672-013-0134-1. Epub 2013 Jan 30.
• [24] Gender-Specific Associations between CHGB Genetic Variants and Schizophrenia in a Korean Population.Yonsei Med J. 2017 May;58(3):619-625. doi: 10.3349/ymj.2017.58.3.619.
• [25] Circulating chromogranin B levels in patients with acute respiratory failure: data from the FINNALI Study.Biomarkers. 2017 Dec;22(8):775-781. doi: 10.1080/1354750X.2016.1269200. Epub 2017 Jan 3.
• [26] Integrative Epigenetic Analysis Reveals Therapeutic Targets to the DNA Methyltransferase Inhibitor Guadecitabine (SGI-110) in Hepatocellular Carcinoma.Hepatology. 2018 Oct;68(4):1412-1428. doi: 10.1002/hep.30091.
• [27] Mood disorders in first- and second-generation immigrants: systematic review and meta-analysis.Br J Psychiatry. 2017 Mar;210(3):182-189. doi: 10.1192/bjp.bp.116.181107. Epub 2017 Jan 9.
• [28] Chromogranin A and neuron-specific enolase in neuroblastoma: Correlation to stage and prognostic factors.Pediatr Hematol Oncol. 2018 Mar;35(2):156-165. doi: 10.1080/08880018.2018.1464087. Epub 2018 May 8.
• [29] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [30] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [31] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [32] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [33] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [34] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [37] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [38] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.