Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7W0EB8)

• DOT Name: SURP and G-patch domain-containing protein 1 (SUGP1)
• Synonyms: RNA-binding protein RBP; Splicing factor 4
• Gene Name: SUGP1
• Related Disease:
  Non-insulin dependent diabetes
  Adult glioblastoma
  Adult T-cell leukemia/lymphoma
  Alcoholic cirrhosis of liver
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Atrial fibrillation
  Autoimmune disease
  Brain neoplasm
  Carcinoma of esophagus
  Cardiac failure
  Colon cancer
  Colon carcinoma
  Dilated cardiomyopathy 1A
  Esophageal cancer
  Fatty liver disease
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Influenza
  Kaposi sarcoma
  Lung cancer
  Lung carcinoma
  Multiple sclerosis
  Neoplasm of esophagus
  Nervous system inflammation
  Obesity
  Psoriasis
  Schizophrenia
  Stroke
  Type-1/2 diabetes
  Choriocarcinoma
  Prostate cancer
  Coronary heart disease
  Neoplasm
  Prostate carcinoma
  Small lymphocytic lymphoma
• UniProt ID: SUGP1_HUMAN
• PDB ID: 8EJM; 8GXL; 8GXM
• Pfam ID: PF01585 ; PF01805
• Sequence:
  MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVA
  SPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPTPS
  AGKRSLLISRRTGLGLASLPGPVKSYSHAKQLPVAHRPSVFQSPDEDEEEDYEQWLEIKV
  SPPEGAETRKVIEKLARFVAEGGPELEKVAMEDYKDNPAFAFLHDKNSREFLYYRKKVAE
  IRKEAQKSQAASQKVSPPEDEEVKNLAEKLARFIADGGPEVETIALQNNRENQAFSFLYE
  PNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPA
  PTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKG
  LGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQ
  HGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMET
  FKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVD
  GAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY
• Function: Plays a role in pre-mRNA splicing.
• Tissue Specificity: Detected in adult testis and heart, and in adult and fetal brain, kidney and skeletal muscle.
• Reactome Pathway: mRNA Splicing - Major Pathway (R-HSA-72163)

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Genetic Variation	[1]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[2]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Altered Expression	[3]
Alcoholic cirrhosis of liver	DISQ1WRT	Strong	Genetic Variation	[4]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[5]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[6]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[7]
Autoimmune disease	DISORMTM	Strong	Biomarker	[8]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[9]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[10]
Cardiac failure	DISDC067	Strong	Genetic Variation	[7]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[12]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[10]
Fatty liver disease	DIS485QZ	Strong	Genetic Variation	[13]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[14]
Influenza	DIS3PNU3	Strong	Biomarker	[15]
Kaposi sarcoma	DISC1H1Z	Strong	Biomarker	[16]
Lung cancer	DISCM4YA	Strong	Biomarker	[17]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[18]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[10]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[18]
Obesity	DIS47Y1K	Strong	Genetic Variation	[13]
Psoriasis	DIS59VMN	Strong	Biomarker	[19]
Schizophrenia	DISSRV2N	Strong	Biomarker	[20]
Stroke	DISX6UHX	Strong	Genetic Variation	[7]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[7]
Choriocarcinoma	DISDBVNL	moderate	Biomarker	[21]
Prostate cancer	DISF190Y	moderate	Biomarker	[22]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[23]
Neoplasm	DISZKGEW	Limited	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[22]
Small lymphocytic lymphoma	DIS30POX	Limited	Genetic Variation	[25]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of SURP and G-patch domain-containing protein 1 (SUGP1).	[26]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of SURP and G-patch domain-containing protein 1 (SUGP1).	[34]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[27]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[28]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[29]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[30]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[33]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN increases the expression of SURP and G-patch domain-containing protein 1 (SUGP1).	[35]

References

• [1] Genome-wide association analyses identify 143 risk variants and putative regulatory mechanisms for type 2 diabetes.Nat Commun. 2018 Jul 27;9(1):2941. doi: 10.1038/s41467-018-04951-w.
• [2] The oncogenic RNA-binding protein Musashi1 is regulated by HuR via mRNA translation and stability in glioblastoma cells.Mol Cancer Res. 2012 Jan;10(1):143-55. doi: 10.1158/1541-7786.MCR-11-0208.
• [3] Oncogenic forms of NOTCH1 lacking either the primary binding site for RBP-Jkappa or nuclear localization sequences retain the ability to associate with RBP-Jkappa and activate transcription.J Biol Chem. 1997 Apr 25;272(17):11336-43. doi: 10.1074/jbc.272.17.11336.
• [4] A genome-wide association study confirms PNPLA3 and identifies TM6SF2 and MBOAT7 as risk loci for alcohol-related cirrhosis.Nat Genet. 2015 Dec;47(12):1443-8. doi: 10.1038/ng.3417. Epub 2015 Oct 19.
• [5] Opposite Dysregulation of Fragile-X Mental Retardation Protein and Heteronuclear Ribonucleoprotein C Protein Associates with Enhanced APP Translation in Alzheimer Disease.Mol Neurobiol. 2016 Jul;53(5):3227-3234. doi: 10.1007/s12035-015-9229-8. Epub 2015 Jun 6.
• [6] Distinct and shared functions of ALS-associated proteins TDP-43, FUS and TAF15 revealed by multisystem analyses.Nat Commun. 2016 Jul 5;7:12143. doi: 10.1038/ncomms12143.
• [7] Pleiotropic Meta-Analyses of Longitudinal Studies Discover Novel Genetic Variants Associated with Age-Related Diseases.Front Genet. 2016 Oct 13;7:179. doi: 10.3389/fgene.2016.00179. eCollection 2016.
• [8] Arid5a stabilizes OX40 mRNA in murine CD4(+) Tcells by recognizing a stem-loop structure in its 3'UTR.Eur J Immunol. 2018 Apr;48(4):593-604. doi: 10.1002/eji.201747109. Epub 2018 Feb 5.
• [9] Alternative polyadenylation in glioblastoma multiforme and changes in predicted RNA binding protein profiles.OMICS. 2013 Mar;17(3):136-49. doi: 10.1089/omi.2012.0098. Epub 2013 Feb 19.
• [10] Overexpression of miR-214-3p in esophageal squamous cancer cells enhances sensitivity to cisplatin by targeting survivin directly and indirectly through CUG-BP1.Oncogene. 2016 Apr 21;35(16):2087-97. doi: 10.1038/onc.2015.271. Epub 2015 Aug 3.
• [11] Butyrate mediated regulation of RNA binding proteins in the post-transcriptional regulation of inflammatory gene expression.Cell Signal. 2019 Dec;64:109410. doi: 10.1016/j.cellsig.2019.109410. Epub 2019 Sep 2.
• [12] Enhanced expression and autoimmunity of recombination signal binding protein-jkappa in human dilated cardiomyopathy.Biochem Biophys Res Commun. 1999 Dec 20;266(2):432-6. doi: 10.1006/bbrc.1999.1855.
• [13] Genome-wide analysis of hepatic lipid content in extreme obesity.Acta Diabetol. 2015 Apr;52(2):373-82. doi: 10.1007/s00592-014-0654-3. Epub 2014 Sep 23.
• [14] Transcriptome-Wide Analysis Reveals the Landscape of Aberrant Alternative Splicing Events in Liver Cancer.Hepatology. 2019 Jan;69(1):359-375. doi: 10.1002/hep.30158. Epub 2018 Dec 18.
• [15] Translational regulation of viral secretory proteins by the 5' coding regions and a viral RNA-binding protein.J Cell Biol. 2017 Aug 7;216(8):2283-2293. doi: 10.1083/jcb.201702102. Epub 2017 Jul 10.
• [16] Notch signal transduction induces a novel profile of Kaposi's sarcoma-associated herpesvirus gene expression.J Microbiol. 2006 Apr;44(2):217-25.
• [17] Quaking orchestrates a post-transcriptional regulatory network of endothelial cell cycle progression critical to angiogenesis and metastasis.Oncogene. 2019 Jun;38(26):5191-5210. doi: 10.1038/s41388-019-0786-6. Epub 2019 Mar 27.
• [18] Dysfunctional RNA-binding protein biology and neurodegeneration in experimental autoimmune encephalomyelitis in female mice.J Neurosci Res. 2020 Apr;98(4):704-717. doi: 10.1002/jnr.24554. Epub 2019 Nov 22.
• [19] Kidney involvement in psoriasis: a case-control study from China.Int Urol Nephrol. 2017 Nov;49(11):1999-2003. doi: 10.1007/s11255-017-1692-x. Epub 2017 Sep 22.
• [20] A model-based approach to characterize the population pharmacokinetics and the relationship between the pharmacokinetic and safety profiles of RBP-7000, a new, long-acting, sustained-released formulation of risperidone.J Clin Pharmacol. 2013 Oct;53(10):1010-9. doi: 10.1002/jcph.141. Epub 2013 Jul 19.
• [21] Regulation of Mcl-1 by SRSF1 and SRSF5 in cancer cells.PLoS One. 2012;7(12):e51497. doi: 10.1371/journal.pone.0051497. Epub 2012 Dec 17.
• [22] Long non-coding RNAs harboring miRNA seed regions are enriched in prostate cancer exosomes.Sci Rep. 2016 Apr 22;6:24922. doi: 10.1038/srep24922.
• [23] SUGP1 is a novel regulator of cholesterol metabolism.Hum Mol Genet. 2016 Jul 15;25(14):3106-3116. doi: 10.1093/hmg/ddw151. Epub 2016 May 20.
• [24] RNA-binding protein PUM2 suppresses osteosarcoma progression via partly and competitively binding to STARD13 3'UTR with miRNAs.Cell Prolif. 2018 Dec;51(6):e12508. doi: 10.1111/cpr.12508. Epub 2018 Aug 7.
• [25] Leukemia development initiated by deletion of RBP-J: mouse strain, deletion efficiency and cell of origin.Dis Model Mech. 2018 Dec 18;11(12):dmm036731. doi: 10.1242/dmm.036731.
• [26] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [27] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [28] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [29] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [30] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [31] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [32] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [33] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [34] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [35] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.