Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8FL49L)

• DOT Name: G0/G1 switch protein 2 (G0S2)
• Synonyms: G0/G1 switch regulatory protein 2; Putative lymphocyte G0/G1 switch gene
• Gene Name: G0S2
• Related Disease:
  Carcinoma
  Invasive breast carcinoma
  Metabolic disorder
  Neoplasm
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Estrogen-receptor positive breast cancer
  Fatty liver disease
  Glioblastoma multiforme
  Lung cancer
  Lung carcinoma
  Non-small-cell lung cancer
  Obesity
  Rheumatoid arthritis
  Liposarcoma
  Precancerous condition
  Undifferentiated carcinoma
  Cutaneous squamous cell carcinoma
  Glioma
  Non-insulin dependent diabetes
  Promyelocytic leukaemia
• UniProt ID: G0S2_HUMAN
• Pfam ID: PF15103
• Sequence:
  METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQE
  AAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
• Function: Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.
• Tissue Specificity: Widely expressed with highest levels in peripheral blood, skeletal muscle and heart, followed by kidney and liver.
• Reactome Pathway: PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Invasive breast carcinoma	DISANYTW	Definitive	Biomarker	[2]
Metabolic disorder	DIS71G5H	Definitive	Biomarker	[3]
Neoplasm	DISZKGEW	Definitive	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Altered Expression	[4]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[6]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[7]
Lung cancer	DISCM4YA	Strong	Biomarker	[8]
Lung carcinoma	DISTR26C	Strong	Biomarker	[8]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[5]
Obesity	DIS47Y1K	Strong	Altered Expression	[9]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[10]
Liposarcoma	DIS8IZVM	moderate	Altered Expression	[11]
Precancerous condition	DISV06FL	moderate	Biomarker	[11]
Undifferentiated carcinoma	DISIAZST	Disputed	Biomarker	[1]
Cutaneous squamous cell carcinoma	DIS3LXUG	Limited	Altered Expression	[12]
Glioma	DIS5RPEH	Limited	Altered Expression	[7]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[13]
Promyelocytic leukaemia	DISYGG13	Limited	Biomarker	[5]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	G0/G1 switch protein 2 (G0S2) affects the response to substance of Doxorubicin.	[47]
Mitomycin	DMH0ZJE	Approved	G0/G1 switch protein 2 (G0S2) affects the response to substance of Mitomycin.	[47]
Vinblastine	DM5TVS3	Approved	G0/G1 switch protein 2 (G0S2) affects the response to substance of Vinblastine.	[47]

35 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of G0/G1 switch protein 2 (G0S2).	[14]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of G0/G1 switch protein 2 (G0S2).	[15]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of G0/G1 switch protein 2 (G0S2).	[16]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of G0/G1 switch protein 2 (G0S2).	[17]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of G0/G1 switch protein 2 (G0S2).	[15]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of G0/G1 switch protein 2 (G0S2).	[18]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of G0/G1 switch protein 2 (G0S2).	[19]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of G0/G1 switch protein 2 (G0S2).	[20]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of G0/G1 switch protein 2 (G0S2).	[21]
Selenium	DM25CGV	Approved	Selenium increases the expression of G0/G1 switch protein 2 (G0S2).	[22]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of G0/G1 switch protein 2 (G0S2).	[23]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of G0/G1 switch protein 2 (G0S2).	[24]
Menadione	DMSJDTY	Approved	Menadione affects the expression of G0/G1 switch protein 2 (G0S2).	[19]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of G0/G1 switch protein 2 (G0S2).	[25]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of G0/G1 switch protein 2 (G0S2).	[26]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of G0/G1 switch protein 2 (G0S2).	[27]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of G0/G1 switch protein 2 (G0S2).	[28]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of G0/G1 switch protein 2 (G0S2).	[29]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of G0/G1 switch protein 2 (G0S2).	[27]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of G0/G1 switch protein 2 (G0S2).	[30]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of G0/G1 switch protein 2 (G0S2).	[31]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of G0/G1 switch protein 2 (G0S2).	[32]
Bosentan	DMIOGBU	Approved	Bosentan affects the expression of G0/G1 switch protein 2 (G0S2).	[33]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of G0/G1 switch protein 2 (G0S2).	[34]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of G0/G1 switch protein 2 (G0S2).	[35]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of G0/G1 switch protein 2 (G0S2).	[36]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of G0/G1 switch protein 2 (G0S2).	[37]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of G0/G1 switch protein 2 (G0S2).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of G0/G1 switch protein 2 (G0S2).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of G0/G1 switch protein 2 (G0S2).	[41]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of G0/G1 switch protein 2 (G0S2).	[42]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of G0/G1 switch protein 2 (G0S2).	[43]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of G0/G1 switch protein 2 (G0S2).	[44]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of G0/G1 switch protein 2 (G0S2).	[45]
Paraquat	DMR8O3X	Investigative	Paraquat affects the expression of G0/G1 switch protein 2 (G0S2).	[46]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of G0/G1 switch protein 2 (G0S2).	[38]

References

• [1] Global gene expression profiling of chemically induced rat mammary gland carcinomas and adenomas.Toxicol Pathol. 2005;33(7):768-75. doi: 10.1080/01926230500437027.
• [2] G0/G1 Switch 2 Induces Cell Survival and Metastasis through Integrin-Mediated Signal Transduction in Human Invasive Breast Cancer Cells.Biomol Ther (Seoul). 2019 Nov 1;27(6):591-602. doi: 10.4062/biomolther.2019.063.
• [3] The g0/g1 switch gene 2 is an important regulator of hepatic triglyceride metabolism.PLoS One. 2013 Aug 12;8(8):e72315. doi: 10.1371/journal.pone.0072315. eCollection 2013.
• [4] G0S2 represses PI3K/mTOR signaling and increases sensitivity to PI3K/mTOR pathway inhibitors in breast cancer.Cell Cycle. 2017;16(21):2146-2155. doi: 10.1080/15384101.2017.1371884. Epub 2017 Sep 14.
• [5] Inhibition of adipose triglyceride lipase (ATGL) by the putative tumor suppressor G0S2 or a small molecule inhibitor attenuates the growth of cancer cells.Oncotarget. 2015 Sep 29;6(29):28282-95. doi: 10.18632/oncotarget.5061.
• [6] Activation of G0/G1 switch gene 2 by endoplasmic reticulum stress enhances hepatic steatosis.Metabolism. 2019 Oct;99:32-44. doi: 10.1016/j.metabol.2019.06.015. Epub 2019 Jul 2.
• [7] Lipolytic inhibitor G0S2 modulates glioma stem-like cell radiation response.J Exp Clin Cancer Res. 2019 Apr 5;38(1):147. doi: 10.1186/s13046-019-1151-x.
• [8] Identification of G0S2 as a gene frequently methylated in squamous lung cancer by combination of in silico and experimental approaches.Int J Cancer. 2010 Apr 15;126(8):1895-1902. doi: 10.1002/ijc.24947.
• [9] Regulation of G0/G1 switch gene 2 (G0S2) expression in human adipose tissue.Arch Physiol Biochem. 2016;122(2):47-53. doi: 10.3109/13813455.2015.1122066. Epub 2016 Jan 27.
• [10] Gene expression profile predicting the response to anti-TNF treatment in patients with rheumatoid arthritis; analysis of GEO datasets.Joint Bone Spine. 2014 Jul;81(4):325-30. doi: 10.1016/j.jbspin.2014.01.013. Epub 2014 Feb 20.
• [11] Epistatic interaction between the lipase-encoding genes Pnpla2 and Lipe causes liposarcoma in mice.PLoS Genet. 2017 May 1;13(5):e1006716. doi: 10.1371/journal.pgen.1006716. eCollection 2017 May.
• [12] Silencing of G0/G1 switch gene 2 in cutaneous squamous cell carcinoma.PLoS One. 2017 Oct 26;12(10):e0187047. doi: 10.1371/journal.pone.0187047. eCollection 2017.
• [13] Reduced mRNA and protein expression of perilipin A and G0/G1 switch gene 2 (G0S2) in human adipose tissue in poorly controlled type 2 diabetes.J Clin Endocrinol Metab. 2012 Jul;97(7):E1348-52. doi: 10.1210/jc.2012-1159. Epub 2012 Apr 24.
• [14] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [15] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [16] Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
• [17] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [18] A comprehensive analysis of Wnt/beta-catenin signaling pathway-related genes and crosstalk pathways in the treatment of As2O3 in renal cancer. Ren Fail. 2018 Nov;40(1):331-339.
• [19] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [20] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [21] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [22] Changes in gene expression profiles in response to selenium supplementation among individuals with arsenic-induced pre-malignant skin lesions. Toxicol Lett. 2007 Mar 8;169(2):162-76. doi: 10.1016/j.toxlet.2007.01.006. Epub 2007 Jan 19.
• [23] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [24] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [25] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [26] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [27] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [28] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [29] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [30] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [31] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [32] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [33] Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
• [34] Resveratrol inhibits pancreatic cancer cell proliferation through transcriptional induction of macrophage inhibitory cytokine-1. J Surg Res. 2007 Apr;138(2):163-9. doi: 10.1016/j.jss.2006.05.037. Epub 2007 Jan 25.
• [35] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [36] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [37] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [38] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [39] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [40] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [41] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [42] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [43] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [44] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [45] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [46] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [47] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.