Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAZVODU)

• DOT Name: PDZ and LIM domain protein 7 (PDLIM7)
• Synonyms: LIM mineralization protein; LMP; Protein enigma
• Gene Name: PDLIM7
• Related Disease:
  Esophageal squamous cell carcinoma
  Extranodal NK/T-cell Lymphoma
  Undifferentiated carcinoma
  Adenocarcinoma
  Adult lymphoma
  Advanced cancer
  AIDS-related lymphoma
  Anal intraepithelial neoplasia
  Anaplastic large cell lymphoma
  Ankylosing spondylitis
  Autoimmune disease
  Bone osteosarcoma
  Central nervous system lymphoma
  Cervical carcinoma
  Colon carcinoma
  Colorectal carcinoma
  Epithelial neoplasm
  Gastric cancer
  Graves disease
  HIV infectious disease
  Immunodeficiency
  Large cell lymphoma
  Lymphoma
  Multiple sclerosis
  Myasthenia gravis
  Niemann-Pick disease type C
  Osteosarcoma
  Pediatric lymphoma
  Severe combined immunodeficiency
  Squamous cell carcinoma
  Systemic lupus erythematosus
  T-cell lymphoma
  Type-1 diabetes
  Head-neck squamous cell carcinoma
  Major depressive disorder
  B-cell lymphoma
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Carcinoma
  Chromosomal disorder
  Lymphoproliferative syndrome
  Precancerous condition
  Prostate carcinoma
  Stomach cancer
• UniProt ID: PDLI7_HUMAN
• PDB ID: 2Q3G; 7RM8
• Pfam ID: PF00412 ; PF00595
• Sequence:
  MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
  LTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFG
  APPPADSAPQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
  DPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTS
  TVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHA
  YHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTW
  HVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS
  WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV
• Function: May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved in both of the two fundamental mechanisms of bone formation, direct bone formation (e.g. embryonic flat bones mandible and cranium), and endochondral bone formation (e.g. embryonic long bone development). Plays a role during fracture repair. Involved in BMP6 signaling pathway.
• Tissue Specificity: Isoform 1 and isoform 2 are expressed ubiquitously, however, isoform 2 predominates in skeletal muscle, isoform 1 is more abundant in lung, spleen, leukocytes and fetal liver.
• KEGG Pathway: Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway: RET signaling (R-HSA-8853659)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Altered Expression	[1]
Extranodal NK/T-cell Lymphoma	DIS72GCL	Definitive	Altered Expression	[2]
Undifferentiated carcinoma	DISIAZST	Definitive	Genetic Variation	[3]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[4]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
AIDS-related lymphoma	DISSLRAU	Strong	Biomarker	[7]
Anal intraepithelial neoplasia	DISJ0JW3	Strong	Altered Expression	[8]
Anaplastic large cell lymphoma	DISP4D1R	Strong	Biomarker	[9]
Ankylosing spondylitis	DISRC6IR	Strong	Genetic Variation	[10]
Autoimmune disease	DISORMTM	Strong	Altered Expression	[11]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[12]
Central nervous system lymphoma	DISBYQTA	Strong	Altered Expression	[13]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[14]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[15]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[16]
Epithelial neoplasm	DIS0T594	Strong	Altered Expression	[17]
Gastric cancer	DISXGOUK	Strong	Biomarker	[18]
Graves disease	DISU4KOQ	Strong	Altered Expression	[19]
HIV infectious disease	DISO97HC	Strong	Biomarker	[20]
Immunodeficiency	DIS093I0	Strong	Biomarker	[21]
Large cell lymphoma	DISYZHCP	Strong	Altered Expression	[22]
Lymphoma	DISN6V4S	Strong	Biomarker	[5]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[23]
Myasthenia gravis	DISELRCI	Strong	Biomarker	[24]
Niemann-Pick disease type C	DIS492ZO	Strong	Biomarker	[25]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[12]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[5]
Severe combined immunodeficiency	DIS6MF4Q	Strong	Genetic Variation	[26]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[27]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[28]
T-cell lymphoma	DISSXRTQ	Strong	Biomarker	[29]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[30]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Biomarker	[31]
Major depressive disorder	DIS4CL3X	moderate	Biomarker	[32]
B-cell lymphoma	DISIH1YQ	Limited	Biomarker	[33]
Bipolar disorder	DISAM7J2	Limited	Biomarker	[34]
Breast cancer	DIS7DPX1	Limited	Genetic Variation	[35]
Breast carcinoma	DIS2UE88	Limited	Genetic Variation	[35]
Carcinoma	DISH9F1N	Limited	Biomarker	[36]
Chromosomal disorder	DISM5BB5	Limited	Altered Expression	[37]
Lymphoproliferative syndrome	DISMVL8O	Limited	Biomarker	[38]
Precancerous condition	DISV06FL	Limited	Biomarker	[39]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[40]
Stomach cancer	DISKIJSX	Limited	Biomarker	[18]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	PDZ and LIM domain protein 7 (PDLIM7) affects the response to substance of Methotrexate.	[64]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of PDZ and LIM domain protein 7 (PDLIM7).	[41]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of PDZ and LIM domain protein 7 (PDLIM7).	[60]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[42]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[43]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[44]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[45]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[46]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[47]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[48]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[49]
Selenium	DM25CGV	Approved	Selenium increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[50]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[51]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[52]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[53]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[54]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[55]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[56]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[57]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[47]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[58]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[59]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[61]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[62]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of PDZ and LIM domain protein 7 (PDLIM7).	[63]

References

• [1] LMP gene promoter hypermethylation is a mechanism for its down regulation in Kazak's esophageal squamous cell carcinomas.Mol Biol Rep. 2013 Mar;40(3):2069-75. doi: 10.1007/s11033-012-2138-2. Epub 2013 Jan 3.
• [2] Specific Soft-Tissue Invasion and LMP1 Expression Are Potential Indicators of Extranodal NK/T Cell Lymphoma, Nasal Type.Med Sci Monit. 2018 Oct 25;24:7603-7613. doi: 10.12659/MSM.909152.
• [3] Epstein-Barr virus latent membrane protein-1 (LMP-1) 30-bp deletion and Xho I-loss is associated with type III nasopharyngeal carcinoma in Malaysia.World J Surg Oncol. 2008 Feb 15;6:18. doi: 10.1186/1477-7819-6-18.
• [4] High levels of Epstein-Barr virus DNA in latently infected gastric adenocarcinoma.Lab Invest. 2009 Jan;89(1):80-90. doi: 10.1038/labinvest.2008.103. Epub 2008 Nov 10.
• [5] The JAK inhibitor antcin H exhibits direct anticancer activity while enhancing chemotherapy against LMP1-expressed lymphoma.Leuk Lymphoma. 2019 May;60(5):1193-1203. doi: 10.1080/10428194.2018.1512709. Epub 2018 Oct 2.
• [6] mTORC2-mediated PDHE1 nuclear translocation links EBV-LMP1 reprogrammed glucose metabolism to cancer metastasis in nasopharyngeal carcinoma.Oncogene. 2019 Jun;38(24):4669-4684. doi: 10.1038/s41388-019-0749-y. Epub 2019 Feb 11.
• [7] Molecular profile of Epstein-Barr virus infection in HHV-8-positive primary effusion lymphoma.Leukemia. 2000 Feb;14(2):271-7. doi: 10.1038/sj.leu.2401651.
• [8] Detection of Epstein-Barr virus genome and latent infection gene expression in normal epithelia, epithelial dysplasia, and squamous cell carcinoma of the oral cavity.Tumour Biol. 2016 Mar;37(3):3389-404. doi: 10.1007/s13277-015-4167-7. Epub 2015 Oct 8.
• [9] Epstein-Barr virus in CD30 anaplastic large cell lymphoma involving the skin and lymphomatoid papulosis in South Korea.Int J Dermatol. 2006 Nov;45(11):1312-6. doi: 10.1111/j.1365-4632.2006.02951.x.
• [10] Association of a specific ERAP1/ARTS1 haplotype with disease susceptibility in ankylosing spondylitis.Arthritis Rheum. 2009 May;60(5):1317-23. doi: 10.1002/art.24467.
• [11] Latent membrane protein 1 and the B lymphocyte-a complex relationship.Crit Rev Immunol. 2014;34(3):177-98. doi: 10.1615/critrevimmunol.2014010041.
• [12] LIM mineralization protein-1 inhibits the malignant phenotypes of human osteosarcoma cells.Int J Mol Sci. 2014 Apr 23;15(4):7037-48. doi: 10.3390/ijms15047037.
• [13] Interferon regulatory factor 4 is involved in Epstein-Barr virus-mediated transformation of human B lymphocytes.J Virol. 2008 Jul;82(13):6251-8. doi: 10.1128/JVI.00163-08. Epub 2008 Apr 16.
• [14] AJUBA increases the cisplatin resistance through hippo pathway in cervical cancer.Gene. 2018 Feb 20;644:148-154. doi: 10.1016/j.gene.2017.11.017. Epub 2017 Nov 7.
• [15] Functional interaction of Ugene and EBV infection mediates tumorigenic effects.Oncogene. 2011 Jun 30;30(26):2921-32. doi: 10.1038/onc.2011.16. Epub 2011 Feb 14.
• [16] Epstein-Barr virus and its association with Fascin expression in colorectal cancers in the Syrian population: A tissue microarray study.Hum Vaccin Immunother. 2017 Jul 3;13(7):1573-1578. doi: 10.1080/21645515.2017.1302046. Epub 2017 Mar 28.
• [17] Epstein-Barr virus-encoded LMP2A regulates viral and cellular gene expression by modulation of the NF-kappaB transcription factor pathway.Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15730-5. doi: 10.1073/pnas.0402135101. Epub 2004 Oct 21.
• [18] Epstein-Barr virus-encoded latent membrane protein-1 upregulates 14-3-3 and Reprimo to confer G(2)/M phase cell cycle arrest.C R Biol. 2012 Dec;335(12):713-21. doi: 10.1016/j.crvi.2012.11.002. Epub 2012 Dec 25.
• [19] The role of Epstein-Barr virus infection in the development of autoimmune thyroid diseases.Endokrynol Pol. 2015;66(2):132-6. doi: 10.5603/EP.2015.0020.
• [20] High frequency of a 30-bp deletion of Epstein-Barr virus latent membrane protein 1 gene in primary HIV non-Hodgkin's brain lymphomas.Neuropathol Appl Neurobiol. 2002 Dec;28(6):471-9. doi: 10.1046/j.1365-2990.2002.t01-1-00418.x.
• [21] LMP1-deficient Epstein-Barr virus mutant requires T cells for lymphomagenesis.J Clin Invest. 2015 Jan;125(1):304-15. doi: 10.1172/JCI76357. Epub 2014 Dec 8.
• [22] AIDS-related non-Hodgkin's lymphomas: from pathology and molecular pathogenesis to treatment.Hum Pathol. 2002 Apr;33(4):392-404. doi: 10.1053/hupa.2002.124723.
• [23] Evidence from genome wide association studies implicates reduced control of Epstein-Barr virus infection in multiple sclerosis susceptibility.Genome Med. 2019 Apr 30;11(1):26. doi: 10.1186/s13073-019-0640-z.
• [24] Epstein-Barr virus in tumor-infiltrating B cells of myasthenia gravis thymoma: an innocent bystander or an autoimmunity mediator?.Oncotarget. 2017 Sep 8;8(56):95432-95449. doi: 10.18632/oncotarget.20731. eCollection 2017 Nov 10.
• [25] Targeting Exosomal EBV-LMP1 Transfer and miR-203 Expression via the NF-B Pathway: The Therapeutic Role of Aspirin in NPC.Mol Ther Nucleic Acids. 2019 Sep 6;17:175-184. doi: 10.1016/j.omtn.2019.05.023. Epub 2019 Jun 7.
• [26] Latent membrane protein 1 is critical for efficient growth transformation of human B cells by epstein-barr virus.Cancer Res. 2003 Jun 1;63(11):2982-9.
• [27] Co-Incidence of Epstein-Barr Virus and High-Risk Human Papillomaviruses in Cervical Cancer of Syrian Women.Front Oncol. 2018 Jul 2;8:250. doi: 10.3389/fonc.2018.00250. eCollection 2018.
• [28] The Possible Effect of B-Cell Epitopes of Epstein-Barr Virus Early Antigen, Membrane Antigen, Latent Membrane Protein-1, and -2A on Systemic Lupus Erythematosus.Front Immunol. 2018 Feb 12;9:187. doi: 10.3389/fimmu.2018.00187. eCollection 2018.
• [29] A neutralized human LMP1-IgG inhibits ENKTL growth by suppressing the JAK3/STAT3 signaling pathway.Oncotarget. 2017 Feb 14;8(7):10954-10965. doi: 10.18632/oncotarget.14032.
• [30] Susceptibility to type 1 diabetes in the Senegalese population is linked to HLA-DQ and not TAP and LMP genes.Diabetes Care. 1997 Aug;20(8):1299-303. doi: 10.2337/diacare.20.8.1299.
• [31] Epstein-Barr virus (EBV)-encoded small RNAs (EBERs) associated with poor prognosis of head and neck carcinomas.Oncotarget. 2017 Apr 18;8(16):27328-27338. doi: 10.18632/oncotarget.16033.
• [32] No Alterations of Brain Structural Asymmetry in Major Depressive Disorder: An ENIGMA Consortium Analysis.Am J Psychiatry. 2019 Dec 1;176(12):1039-1049. doi: 10.1176/appi.ajp.2019.18101144. Epub 2019 Jul 29.
• [33] Regulation of S1PR2 by the EBV oncogene LMP1 in aggressive ABC-subtype diffuse large B-cell lymphoma.J Pathol. 2019 Jun;248(2):142-154. doi: 10.1002/path.5237. Epub 2019 Mar 22.
• [34] Using structural MRI to identify bipolar disorders - 13 site machine learning study in 3020 individuals from the ENIGMA Bipolar Disorders Working Group.Mol Psychiatry. 2020 Sep;25(9):2130-2143. doi: 10.1038/s41380-018-0228-9. Epub 2018 Aug 31.
• [35] Full in-frame exon 3 skipping of BRCA2 confers high risk of breast and/or ovarian cancer.Oncotarget. 2018 Apr 3;9(25):17334-17348. doi: 10.18632/oncotarget.24671. eCollection 2018 Apr 3.
• [36] Tetraspanin CD63 Bridges Autophagic and Endosomal Processes To Regulate Exosomal Secretion and Intracellular Signaling of Epstein-Barr Virus LMP1.J Virol. 2018 Feb 12;92(5):e01969-17. doi: 10.1128/JVI.01969-17. Print 2018 Mar 1.
• [37] Disruption of direct 3D telomere-TRF2 interaction through two molecularly disparate mechanisms is a hallmark of primary Hodgkin and Reed-Sternberg cells.Lab Invest. 2017 Jul;97(7):772-781. doi: 10.1038/labinvest.2017.33. Epub 2017 Apr 24.
• [38] Mouse model of Epstein-Barr virus LMP1- and LMP2A-driven germinal center B-cell lymphoproliferative disease.Proc Natl Acad Sci U S A. 2017 May 2;114(18):4751-4756. doi: 10.1073/pnas.1701836114. Epub 2017 Mar 28.
• [39] Latent membrane protein 1 suppresses RASSF1A expression, disrupts microtubule structures and induces chromosomal aberrations in human epithelial cells.Oncogene. 2007 May 10;26(21):3069-80. doi: 10.1038/sj.onc.1210106. Epub 2006 Nov 13.
• [40] NF-kappaB activation stimulates transcription and replication of retrovirus XMRV in human B-lineage and prostate carcinoma cells.J Virol. 2011 Apr;85(7):3179-86. doi: 10.1128/JVI.02333-10. Epub 2011 Jan 26.
• [41] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [42] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [43] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [44] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [45] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [46] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [47] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [48] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [49] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [50] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [51] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [52] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [53] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [54] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [55] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [56] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [57] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [58] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [59] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [60] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [61] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [62] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [63] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [64] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.