Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD546E5)

DOT Name Protein MAK16 homolog (MAK16)
Synonyms NNP78; Protein RBM13
Gene Name MAK16
Related Disease
Melanoma ( )
Acute myelogenous leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cervical cancer ( )
Cervical carcinoma ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Diabetic kidney disease ( )
Dilated cardiomyopathy 1A ( )
Endometriosis ( )
Epithelial ovarian cancer ( )
Esophageal cancer ( )
Frontotemporal dementia ( )
Glioblastoma multiforme ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Influenza ( )
Liver cancer ( )
Liver cirrhosis ( )
Lung neoplasm ( )
Neoplasm ( )
Nervous system inflammation ( )
Non-alcoholic fatty liver disease ( )
Non-small-cell lung cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Renal cell carcinoma ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Teratoma ( )
Fragile X syndrome ( )
Pancreatic cancer ( )
Parkinson disease ( )
UniProt ID
MAK16_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8FKP; 8FKR; 8FKT; 8FKV
Pfam ID
PF04874 ; PF01778
Sequence
MQSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQ
CYLYMKVIERAAFPRRLWERVRLSKNYEKALEQIDENLIYWPRFIRHKCKQRFTKITQYL
IRIRKLTLKRQRKLVPLSKKVERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYN
FPIHAFDKALEQQEAESDSSDTEEKDDDDDDEEDVGKREFVEDGEVDESDISDFEDMDKL
DASSDEDQDGKSSSEEEEEKALSAKHKGKMPLRGPLQRKRAYVEIEYEQETEPVAKAKTT

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Definitive Biomarker [1]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [2]
Adult glioblastoma DISVP4LU Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Alzheimer disease DISF8S70 Strong Biomarker [5]
Amyotrophic lateral sclerosis DISF7HVM Strong Genetic Variation [6]
Arteriosclerosis DISK5QGC Strong Biomarker [7]
Atherosclerosis DISMN9J3 Strong Biomarker [7]
Breast cancer DIS7DPX1 Strong Biomarker [8]
Breast carcinoma DIS2UE88 Strong Biomarker [8]
Carcinoma DISH9F1N Strong Genetic Variation [9]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Altered Expression [10]
Cervical cancer DISFSHPF Strong Biomarker [11]
Cervical carcinoma DIST4S00 Strong Biomarker [11]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [12]
Colon cancer DISVC52G Strong Biomarker [13]
Colon carcinoma DISJYKUO Strong Biomarker [13]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [14]
Congestive heart failure DIS32MEA Strong Genetic Variation [15]
Diabetic kidney disease DISJMWEY Strong Biomarker [16]
Dilated cardiomyopathy 1A DIS0RK9Z Strong Genetic Variation [15]
Endometriosis DISX1AG8 Strong Biomarker [17]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [18]
Esophageal cancer DISGB2VN Strong Altered Expression [19]
Frontotemporal dementia DISKYHXL Strong Biomarker [20]
Glioblastoma multiforme DISK8246 Strong Biomarker [3]
Glioma DIS5RPEH Strong Biomarker [21]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [22]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [23]
Influenza DIS3PNU3 Strong Biomarker [24]
Liver cancer DISDE4BI Strong Altered Expression [25]
Liver cirrhosis DIS4G1GX Strong Altered Expression [10]
Lung neoplasm DISVARNB Strong Altered Expression [26]
Neoplasm DISZKGEW Strong Biomarker [27]
Nervous system inflammation DISB3X5A Strong Biomarker [28]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [29]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [30]
Ovarian cancer DISZJHAP Strong Altered Expression [18]
Ovarian neoplasm DISEAFTY Strong Altered Expression [18]
Prostate cancer DISF190Y Strong Biomarker [31]
Prostate carcinoma DISMJPLE Strong Biomarker [31]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [12]
Squamous cell carcinoma DISQVIFL Strong Biomarker [32]
Stomach cancer DISKIJSX Strong Biomarker [33]
Lung cancer DISCM4YA moderate Biomarker [34]
Lung carcinoma DISTR26C moderate Biomarker [34]
Teratoma DIS6ICY4 moderate Altered Expression [35]
Fragile X syndrome DISE8W3A Limited Altered Expression [36]
Pancreatic cancer DISJC981 Limited Biomarker [37]
Parkinson disease DISQVHKL Limited Biomarker [38]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein MAK16 homolog (MAK16). [39]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Protein MAK16 homolog (MAK16). [40]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Protein MAK16 homolog (MAK16). [41]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Protein MAK16 homolog (MAK16). [42]
Marinol DM70IK5 Approved Marinol decreases the expression of Protein MAK16 homolog (MAK16). [43]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Protein MAK16 homolog (MAK16). [45]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Protein MAK16 homolog (MAK16). [46]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Protein MAK16 homolog (MAK16). [47]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Protein MAK16 homolog (MAK16). [44]
------------------------------------------------------------------------------------

References

1 Extracellular vesicle-dependent effect of RNA-binding protein IGF2BP1 on melanoma metastasis.Oncogene. 2019 May;38(21):4182-4196. doi: 10.1038/s41388-019-0797-3. Epub 2019 Apr 1.
2 Targeting an RNA-Binding Protein Network in Acute Myeloid Leukemia.Cancer Cell. 2019 Mar 18;35(3):369-384.e7. doi: 10.1016/j.ccell.2019.01.010. Epub 2019 Feb 21.
3 RNA-Binding Protein Musashi1 Is a Central Regulator of Adhesion Pathways in Glioblastoma.Mol Cell Biol. 2015 Sep 1;35(17):2965-78. doi: 10.1128/MCB.00410-15. Epub 2015 Jun 22.
4 RNA-Binding Protein HuR Regulates Both Mutant and Wild-Type IDH1 in IDH1-Mutated Cancer.Mol Cancer Res. 2019 Feb;17(2):508-520. doi: 10.1158/1541-7786.MCR-18-0557. Epub 2018 Sep 28.
5 Amyloid precursor protein, an androgen-regulated gene, is targeted by RNA-binding protein PSF/SFPQ in neuronal cells.Genes Cells. 2019 Nov;24(11):719-730. doi: 10.1111/gtc.12721. Epub 2019 Oct 15.
6 Single-copy expression of an amyotrophic lateral sclerosis-linked TDP-43 mutation (M337V) in BAC transgenic mice leads to altered stress granule dynamics and progressive motor dysfunction.Neurobiol Dis. 2019 Jan;121:148-162. doi: 10.1016/j.nbd.2018.09.024. Epub 2018 Oct 2.
7 Endothelial HuR deletion reduces the expression of proatherogenic molecules and attenuates atherosclerosis.Int Immunopharmacol. 2018 Dec;65:248-255. doi: 10.1016/j.intimp.2018.09.023. Epub 2018 Oct 17.
8 Cell type-restricted activity of hnRNPM promotes breast cancer metastasis via regulating alternative splicing.Genes Dev. 2014 Jun 1;28(11):1191-203. doi: 10.1101/gad.241968.114. Epub 2014 May 19.
9 Role of the RNA-binding protein HuR in colon carcinogenesis.Oncogene. 2003 Oct 16;22(46):7146-54. doi: 10.1038/sj.onc.1206862.
10 Aberrant expression of fetal RNA-binding protein p62 in liver cancer and liver cirrhosis.Am J Pathol. 2001 Sep;159(3):945-53. doi: 10.1016/S0002-9440(10)61770-1.
11 Msi1 promotes tumor growth and cell proliferation by targeting cell cycle checkpoint proteins p21, p27 and p53 in cervical carcinomas.Oncotarget. 2014 Nov 15;5(21):10870-85. doi: 10.18632/oncotarget.2539.
12 Role of the RNA-binding protein HuR in human renal cell carcinoma.Carcinogenesis. 2010 Jun;31(6):1018-26. doi: 10.1093/carcin/bgq052. Epub 2010 Mar 10.
13 RNA-binding protein quaking, a critical regulator of colon epithelial differentiation and a suppressor of colon cancer.Gastroenterology. 2010 Jan;138(1):231-40.e1-5. doi: 10.1053/j.gastro.2009.08.001. Epub 2009 Aug 15.
14 The RNA-Binding Protein HuR Confers Oxaliplatin Resistance of Colorectal Cancer By Upregulating CDC6.Mol Cancer Ther. 2019 Jul;18(7):1243-1254. doi: 10.1158/1535-7163.MCT-18-0945. Epub 2019 May 7.
15 RNA-binding protein RBM20 represses splicing to orchestrate cardiac pre-mRNA processing.J Clin Invest. 2014 Aug;124(8):3419-30. doi: 10.1172/JCI74523. Epub 2014 Jun 24.
16 Identification of NOD2 as a novel target of RNA-binding protein HuR: evidence from NADPH oxidase-mediated HuR signaling in diabetic nephropathy.Free Radic Biol Med. 2015 Feb;79:217-27. doi: 10.1016/j.freeradbiomed.2014.12.013. Epub 2014 Dec 18.
17 A balancing act: RNA binding protein HuR/TTP axis in endometriosis patients.Sci Rep. 2017 Jul 19;7(1):5883. doi: 10.1038/s41598-017-06081-7.
18 Identification of clinical trait-related lncRNA and mRNA biomarkers with weighted gene co-expression network analysis as useful tool for personalized medicine in ovarian cancer.EPMA J. 2019 Jul 19;10(3):273-290. doi: 10.1007/s13167-019-00175-0. eCollection 2019 Sep.
19 The RNA-binding protein CUG-BP1 increases survivin expression in oesophageal cancer cells through enhanced mRNA stability.Biochem J. 2012 Aug 15;446(1):113-23. doi: 10.1042/BJ20120112.
20 Functional and dynamic polymerization of the ALS-linked protein TDP-43 antagonizes its pathologic aggregation.Nat Commun. 2017 Jun 29;8(1):45. doi: 10.1038/s41467-017-00062-0.
21 Hu antigen R (HuR) multimerization contributes to glioma disease progression.J Biol Chem. 2017 Oct 13;292(41):16999-17010. doi: 10.1074/jbc.M117.797878. Epub 2017 Aug 8.
22 Characterization of squamous cell carcinoma in an organotypic culture via subsurface non-linear optical molecular imaging.Exp Biol Med (Maywood). 2013 Nov 1;238(11):1233-41. doi: 10.1177/1535370213502628. Epub 2013 Oct 1.
23 Lin28b is involved in curcumin-reversed paclitaxel chemoresistance and associated with poor prognosis in hepatocellular carcinoma.J Cancer. 2019 Oct 15;10(24):6074-6087. doi: 10.7150/jca.33421. eCollection 2019.
24 Regulation of eukaryotic protein synthesis: selective influenza viral mRNA translation is mediated by the cellular RNA-binding protein GRSF-1.Proc Natl Acad Sci U S A. 1999 Jun 8;96(12):6694-9. doi: 10.1073/pnas.96.12.6694.
25 RBMY, a male germ cell-specific RNA-binding protein, activated in human liver cancers and transforms rodent fibroblasts.Oncogene. 2004 Jul 29;23(34):5815-22. doi: 10.1038/sj.onc.1207773.
26 Expression of the RNA-binding protein CRD-BP in brain and non-small cell lung tumors.Cancer Lett. 2004 Jun 25;209(2):245-50. doi: 10.1016/j.canlet.2003.12.015.
27 Multiple functions of HuR in urinary tumors.J Cancer Res Clin Oncol. 2019 Jan;145(1):11-18. doi: 10.1007/s00432-018-2778-2. Epub 2018 Oct 28.
28 Dysfunctional RNA-binding protein biology and neurodegeneration in experimental autoimmune encephalomyelitis in female mice.J Neurosci Res. 2020 Apr;98(4):704-717. doi: 10.1002/jnr.24554. Epub 2019 Nov 22.
29 SIRT1 mediates the role of RNA-binding protein QKI 5 in the synthesis of triglycerides in non-alcoholic fatty liver disease mice via the PPAR/FoxO1 signaling pathway.Int J Mol Med. 2019 Mar;43(3):1271-1280. doi: 10.3892/ijmm.2019.4059. Epub 2019 Jan 10.
30 The RNA-binding protein HuR stabilizes cytosolic phospholipase A2 mRNA under interleukin-1 treatment in non-small cell lung cancer A549 Cells.J Biol Chem. 2011 Oct 14;286(41):35499-35508. doi: 10.1074/jbc.M111.263582. Epub 2011 Aug 23.
31 The RNA-binding protein FXR1 modulates prostate cancer progression by regulating FBXO4.Funct Integr Genomics. 2019 May;19(3):487-496. doi: 10.1007/s10142-019-00661-8. Epub 2019 Feb 11.
32 Repression of caspase-3 and RNA-binding protein HuR cleavage by cyclooxygenase-2 promotes drug resistance in oral squamous cell carcinoma.Oncogene. 2017 Jun 1;36(22):3137-3148. doi: 10.1038/onc.2016.451. Epub 2016 Dec 12.
33 The RNA-binding protein PCBP2 facilitates gastric carcinoma growth by targeting miR-34a.Biochem Biophys Res Commun. 2014 Jun 13;448(4):437-42. doi: 10.1016/j.bbrc.2014.04.124. Epub 2014 May 2.
34 HnRNP-L promotes prostate cancer progression by enhancing cell cycling and inhibiting apoptosis.Oncotarget. 2017 Mar 21;8(12):19342-19353. doi: 10.18632/oncotarget.14258.
35 Mammalian germ cells are determined after PGC colonization of the nascent gonad.Proc Natl Acad Sci U S A. 2019 Dec 17;116(51):25677-25687. doi: 10.1073/pnas.1910733116. Epub 2019 Nov 21.
36 Fragile X Syndrome: from molecular pathology to therapy.Neurosci Biobehav Rev. 2014 Oct;46 Pt 2:242-55. doi: 10.1016/j.neubiorev.2014.01.006. Epub 2014 Jan 22.
37 Identification of Upregulated HNRNPs Associated with Poor Prognosis in Pancreatic Cancer.Biomed Res Int. 2019 Jul 4;2019:5134050. doi: 10.1155/2019/5134050. eCollection 2019.
38 Association between the neuron-specific RNA-binding protein ELAVL4 and Parkinson disease.Hum Genet. 2005 Jun;117(1):27-33. doi: 10.1007/s00439-005-1259-2. Epub 2005 Apr 13.
39 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
40 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
41 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
42 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
43 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
44 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
45 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
46 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
47 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.