Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDLGYM3)

DOT Name Golgi phosphoprotein 3 (GOLPH3)
Synonyms Coat protein GPP34; Mitochondrial DNA absence factor; MIDAS
Gene Name GOLPH3
Related Disease
Epithelial ovarian cancer ( )
Fibromyalgia ( )
Melanoma ( )
Alzheimer disease ( )
Astrocytoma ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma of esophagus ( )
Chikungunya virus infection ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Congenital disorder of glycosylation ( )
Endometrial carcinoma ( )
Esophageal cancer ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Hepatitis B virus infection ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
High blood pressure ( )
Linear skin defects with multiple congenital anomalies 1 ( )
Liver cirrhosis ( )
Malignant glioma ( )
Neoplasm of esophagus ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Renal cell carcinoma ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Carcinoma ( )
Influenza ( )
Matthew-Wood syndrome ( )
Pancreatic ductal carcinoma ( )
Anxiety disorder ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Liver cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Adult glioblastoma ( )
Nervous system disease ( )
Neuroblastoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
GOLP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3KN1
Pfam ID
PF05719
Sequence
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRL
TLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKV
ICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKN
LVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALI
YLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Function
Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis.
Tissue Specificity Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Epithelial ovarian cancer DIS56MH2 Definitive Biomarker [1]
Fibromyalgia DISZJDS2 Definitive Biomarker [2]
Melanoma DIS1RRCY Definitive Altered Expression [3]
Alzheimer disease DISF8S70 Strong Biomarker [4]
Astrocytoma DISL3V18 Strong Altered Expression [5]
Bladder cancer DISUHNM0 Strong Biomarker [6]
Breast cancer DIS7DPX1 Strong Biomarker [7]
Breast carcinoma DIS2UE88 Strong Biomarker [7]
Carcinoma of esophagus DISS6G4D Strong Altered Expression [8]
Chikungunya virus infection DISDXEHY Strong Biomarker [9]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [10]
Colon cancer DISVC52G Strong Biomarker [11]
Colon carcinoma DISJYKUO Strong Biomarker [11]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [12]
Congenital disorder of glycosylation DIS400QP Strong Altered Expression [13]
Endometrial carcinoma DISXR5CY Strong Biomarker [14]
Esophageal cancer DISGB2VN Strong Altered Expression [8]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [15]
Gastric cancer DISXGOUK Strong Biomarker [16]
Glioblastoma multiforme DISK8246 Strong Biomarker [17]
Glioma DIS5RPEH Strong Biomarker [18]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [19]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [20]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [21]
High blood pressure DISY2OHH Strong Biomarker [7]
Linear skin defects with multiple congenital anomalies 1 DISNYKBT Strong Biomarker [22]
Liver cirrhosis DIS4G1GX Strong Biomarker [23]
Malignant glioma DISFXKOV Strong Biomarker [24]
Neoplasm of esophagus DISOLKAQ Strong Altered Expression [8]
Ovarian cancer DISZJHAP Strong Biomarker [25]
Ovarian neoplasm DISEAFTY Strong Biomarker [25]
Renal cell carcinoma DISQZ2X8 Strong Altered Expression [10]
Stomach cancer DISKIJSX Strong Biomarker [16]
Urinary bladder cancer DISDV4T7 Strong Biomarker [6]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [6]
Carcinoma DISH9F1N moderate Biomarker [26]
Influenza DIS3PNU3 moderate Altered Expression [27]
Matthew-Wood syndrome DISA7HR7 moderate Altered Expression [28]
Pancreatic ductal carcinoma DIS26F9Q moderate Altered Expression [28]
Anxiety disorder DISBI2BT Disputed Biomarker [29]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Disputed Biomarker [30]
Liver cancer DISDE4BI Disputed Biomarker [30]
Lung cancer DISCM4YA Disputed Altered Expression [31]
Lung carcinoma DISTR26C Disputed Altered Expression [31]
Adult glioblastoma DISVP4LU Limited Biomarker [32]
Nervous system disease DISJ7GGT Limited Biomarker [33]
Neuroblastoma DISVZBI4 Limited Biomarker [34]
Prostate cancer DISF190Y Limited Altered Expression [35]
Prostate carcinoma DISMJPLE Limited Altered Expression [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Golgi phosphoprotein 3 (GOLPH3). [36]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Golgi phosphoprotein 3 (GOLPH3). [37]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Golgi phosphoprotein 3 (GOLPH3). [38]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Golgi phosphoprotein 3 (GOLPH3). [39]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Golgi phosphoprotein 3 (GOLPH3). [40]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Golgi phosphoprotein 3 (GOLPH3). [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Golgi phosphoprotein 3 (GOLPH3). [41]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Golgi phosphoprotein 3 (GOLPH3). [42]
------------------------------------------------------------------------------------

References

1 GOLPH3 induces epithelial-mesenchymal transition via Wnt/-catenin signaling pathway in epithelial ovarian cancer.Cancer Med. 2017 Apr;6(4):834-844. doi: 10.1002/cam4.1040. Epub 2017 Mar 23.
2 Comorbid fibromyalgia in migraine patients: clinical significance and impact on daily life.Neurol Res. 2019 Oct;41(10):909-915. doi: 10.1080/01616412.2019.1630164. Epub 2019 Jun 20.
3 Nuclear pseudoinclusions in melanoma cells: prognostic fact or artifact? The possible role of Golgi phosphoprotein 3 overexpression in nuclear pseudoinclusions generation.Pathol Int. 2018 Feb;68(2):117-122. doi: 10.1111/pin.12629. Epub 2018 Jan 29.
4 Genetic and Expression Analysis of COPI Genes and Alzheimer's Disease Susceptibility.Front Genet. 2019 Sep 19;10:866. doi: 10.3389/fgene.2019.00866. eCollection 2019.
5 Expression of the Golgi phosphoprotein-3 gene in human gliomas: a pilot study.J Neurooncol. 2011 Nov;105(2):159-63. doi: 10.1007/s11060-011-0573-x. Epub 2011 Apr 16.
6 MiR-1/GOLPH3/Foxo1 Signaling Pathway Regulates Proliferation of Bladder Cancer.Technol Cancer Res Treat. 2019 Jan-Dec;18:1533033819886897. doi: 10.1177/1533033819886897.
7 Clinicopathological significance of miR-27b targeting Golgi protein 73 in patients with hepatocellular carcinoma.Anticancer Drugs. 2019 Feb;30(2):186-194. doi: 10.1097/CAD.0000000000000711.
8 High expression of GOLPH3 in esophageal squamous cell carcinoma correlates with poor prognosis.PLoS One. 2012;7(10):e45622. doi: 10.1371/journal.pone.0045622. Epub 2012 Oct 2.
9 Assembly of tomato blistering mosaic virus-like particles using a baculovirus expression vector system.Arch Virol. 2019 Jul;164(7):1753-1760. doi: 10.1007/s00705-019-04262-5. Epub 2019 Apr 25.
10 Golgi Phosphoprotein 3 Promotes Malignant Phenotypes via FAK/Raf/MEK and Wnt/-Catenin Signaling Pathways in Human Renal Cell Carcinoma.J Biomed Nanotechnol. 2019 Aug 1;15(8):1812-1823. doi: 10.1166/jbn.2019.2804.
11 GOLPH3 expression promotes the resistance of HT29 cells to 5fluorouracil by activating multiple signaling pathways.Mol Med Rep. 2018 Jan;17(1):542-548. doi: 10.3892/mmr.2017.7877. Epub 2017 Oct 25.
12 MiR-3150b-3p inhibits the progression of colorectal cancer cells via targeting GOLPH3.J Investig Med. 2020 Feb;68(2):425-429. doi: 10.1136/jim-2019-001124. Epub 2019 Nov 2.
13 COG7 deficiency in Drosophila generates multifaceted developmental, behavioral and protein glycosylation phenotypes.J Cell Sci. 2017 Nov 1;130(21):3637-3649. doi: 10.1242/jcs.209049. Epub 2017 Sep 7.
14 Golgi phosphoprotein 3 (GOLPH3) promotes endometrial carcinoma cell invasion and migration by regulating the epithelial-mesenchymal transition.Cancer Biomark. 2019;26(1):21-30. doi: 10.3233/CBM-190096.
15 GOLPH3 promotes cell proliferation and tumorigenicity in esophageal squamous cell carcinoma via mTOR and Wnt/catenin signal activation.Mol Med Rep. 2017 Nov;16(5):7138-7144. doi: 10.3892/mmr.2017.7495. Epub 2017 Sep 13.
16 MicroRNA-134 suppresses cell proliferation in gastric cancer cells via targeting of GOLPH3.Oncol Rep. 2017 Apr;37(4):2441-2448. doi: 10.3892/or.2017.5488. Epub 2017 Mar 2.
17 The knocking down of the oncoprotein Golgi phosphoprotein 3 in T98G cells of glioblastoma multiforme disrupts cell migration by affecting focal adhesion dynamics in a focal adhesion kinase-dependent manner.PLoS One. 2019 Feb 19;14(2):e0212321. doi: 10.1371/journal.pone.0212321. eCollection 2019.
18 Co-delivery of GOLPH3 siRNA and gefitinib by cationic lipid-PLGA nanoparticles improves EGFR-targeted therapy for glioma.J Mol Med (Berl). 2019 Nov;97(11):1575-1588. doi: 10.1007/s00109-019-01843-4. Epub 2019 Nov 14.
19 Algorithm of Golgi protein 73 and liver stiffness accurately diagnoses significant fibrosis in chronic HBV infection.Liver Int. 2017 Nov;37(11):1612-1621. doi: 10.1111/liv.13536. Epub 2017 Aug 28.
20 GP73 represses host innate immune response to promote virus replication by facilitating MAVS and TRAF6 degradation.PLoS Pathog. 2017 Apr 10;13(4):e1006321. doi: 10.1371/journal.ppat.1006321. eCollection 2017 Apr.
21 A novel oncolytic adenovirus inhibits hepatocellular carcinoma growth.J Zhejiang Univ Sci B. 2019 Dec.;20(12):1003-1013. doi: 10.1631/jzus.B1900089.
22 Mutations in NDUFB11, encoding a complex I component of the mitochondrial respiratory chain, cause microphthalmia with linear skin defects syndrome. Am J Hum Genet. 2015 Apr 2;96(4):640-50. doi: 10.1016/j.ajhg.2015.02.002. Epub 2015 Mar 12.
23 Magnetic Nanoparticle-Based Automatic Chemiluminescent Enzyme Immunoassay for Golgi Protein 73 and the Clinical Assessment.J Nanosci Nanotechnol. 2019 Apr 1;19(4):1971-1977. doi: 10.1166/jnn.2019.16485.
24 Golgi Phosphoprotein 3 Inhibits the Apoptosis of Human Glioma Cells in Part by Downregulating N-myc Downstream Regulated Gene 1.Med Sci Monit. 2016 Oct 4;22:3535-3543. doi: 10.12659/msm.900349.
25 The diagnostic value of determination of serum GOLPH3 associated with CA125, CA19.9 in patients with ovarian cancer.Eur Rev Med Pharmacol Sci. 2017 Sep;21(18):4039-4044.
26 Distinct Biochemical Pools of Golgi Phosphoprotein 3 in the Human Breast Cancer Cell Lines MCF7 and MDA-MB-231.PLoS One. 2016 Apr 28;11(4):e0154719. doi: 10.1371/journal.pone.0154719. eCollection 2016.
27 Luteolin decreases the yield of influenza A virus in vitro by interfering with the coat protein I complex expression.J Nat Med. 2019 Jun;73(3):487-496. doi: 10.1007/s11418-019-01287-7. Epub 2019 Feb 13.
28 Overexpression of GOLPH3 is associated with poor prognosis and clinical progression in pancreatic ductal adenocarcinoma.BMC Cancer. 2014 Aug 7;14:571. doi: 10.1186/1471-2407-14-571.
29 Perceived Pain Extent is Not Associated With Widespread Pressure Pain Sensitivity, Clinical Features, Related Disability, Anxiety, or Depression in Women With Episodic Migraine.Clin J Pain. 2018 Mar;34(3):217-221. doi: 10.1097/AJP.0000000000000537.
30 Hepatitis B virus upregulates GP73 expression by activating the HIF-2 signaling pathway.Oncol Lett. 2018 Apr;15(4):5264-5270. doi: 10.3892/ol.2018.7955. Epub 2018 Feb 5.
31 Cigarette Smoking Condensate Disrupts Endoplasmic Reticulum-Golgi Network Homeostasis Through GOLPH3 Expression in Normal Lung Epithelial Cells.Nicotine Tob Res. 2016 Sep;18(9):1877-1885. doi: 10.1093/ntr/ntw079. Epub 2016 Mar 31.
32 Golgi Phosphoprotein 3 Promotes Wls Recycling and Wnt Secretion in Glioma Progression.Cell Physiol Biochem. 2018;47(6):2445-2457. doi: 10.1159/000491618. Epub 2018 Jul 10.
33 Identification of Novel FAM134B (JK1) Mutations in Oesophageal Squamous Cell Carcinoma.Sci Rep. 2016 Jul 4;6:29173. doi: 10.1038/srep29173.
34 Role of GOLPH3 and TPX2 in Neuroblastoma DNA Damage Response and Cell Resistance to Chemotherapy.Int J Mol Sci. 2019 Sep 25;20(19):4764. doi: 10.3390/ijms20194764.
35 GOLPH2, a gene downstream of ras signaling, promotes the progression of pancreatic ductal adenocarcinoma.Mol Med Rep. 2018 Mar;17(3):4187-4194. doi: 10.3892/mmr.2018.8430. Epub 2018 Jan 15.
36 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
37 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
38 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
39 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
40 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
41 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
42 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
43 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.