Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFSO7PG)

• DOT Name: Elastin (ELN)
• Synonyms: Tropoelastin
• Gene Name: ELN
• Related Disease:
  Abdominal aortic aneurysm
  Arterial disorder
  Cutis laxa, autosomal dominant 1
  Marfan syndrome
  Supravalvular aortic stenosis
  Aortic aneurysm
  Arteriosclerosis
  Atherosclerosis
  Autism
  Autosomal recessive polycystic kidney disease
  Cardiovascular disease
  Costello syndrome
  Depression
  facioscapulohumeral muscular dystrophy
  Fetal growth restriction
  Glaucoma/ocular hypertension
  High blood pressure
  Hypertrophic cardiomyopathy
  Liver cirrhosis
  Myocardial infarction
  Neoplasm
  Non-insulin dependent diabetes
  Obesity
  Pulmonary emphysema
  Skin disease
  Stroke
  Subarachnoid hemorrhage
  Acute myelogenous leukaemia
  Chronic obstructive pulmonary disease
  Autosomal dominant cutis laxa
  Type-1/2 diabetes
  Artery stenosis
  Buschke-Ollendorff syndrome
  Familial thoracic aortic aneurysm and aortic dissection
  Hypercalcaemia
  Intellectual disability
  Moyamoya disease
  Myocardial ischemia
  Pneumothorax
  Pseudoxanthoma elasticum
  Pulmonary disease
  Pulmonary fibrosis
• UniProt ID: ELN_HUMAN
• Sequence:
  MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGG
  KPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGG
  LGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAP
  GVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAG
  KAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGT
  PAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIP
  GAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGV
  PGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGAPGAVPGVPGTGGV
  PGVGTPAAAAAKAAAKAAQFGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAP
  GVGVAPGIGPGGVAAAAKSAAKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGL
  GVGAGVPGFGAGADEGVRRSLSPELREGDPSSSQHLPSTPSSPRVPGALAAAKAAKYGAA
  VPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVP
  GVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKA
  CGRKRK
• Function: Major structural protein of tissues such as aorta and nuchal ligament, which must expand rapidly and recover completely. Molecular determinant of the late arterial morphogenesis, stabilizing arterial structure by regulating proliferation and organization of vascular smooth muscle.
• Tissue Specificity: Expressed within the outer myometrial smooth muscle and throughout the arteriolar tree of uterus (at protein level). Also expressed in the large arteries, lung and skin.
• KEGG Pathway:
  Cytoskeleton in muscle cells (hsa04820)
  Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Elastic fibre formation (R-HSA-1566948)
  Molecules associated with elastic fibres (R-HSA-2129379)
  Degradation of the extracellular matrix (R-HSA-1474228)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Abdominal aortic aneurysm	DISD06OF	Definitive	Biomarker	[1]
Arterial disorder	DISLG4XS	Definitive	Biomarker	[2]
Cutis laxa, autosomal dominant 1	DISZR0A4	Definitive	Autosomal dominant	[3]
Marfan syndrome	DISVEUWZ	Definitive	Biomarker	[4]
Supravalvular aortic stenosis	DIS8FSJD	Definitive	Autosomal dominant	[5]
Aortic aneurysm	DISQ5KRA	Strong	Altered Expression	[6]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[7]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[7]
Autism	DISV4V1Z	Strong	Biomarker	[8]
Autosomal recessive polycystic kidney disease	DISPUS40	Strong	Biomarker	[9]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[10]
Costello syndrome	DISXVJH3	Strong	Posttranslational Modification	[11]
Depression	DIS3XJ69	Strong	Genetic Variation	[12]
facioscapulohumeral muscular dystrophy	DISSE0H0	Strong	Biomarker	[13]
Fetal growth restriction	DIS5WEJ5	Strong	Biomarker	[14]
Glaucoma/ocular hypertension	DISLBXBY	Strong	Genetic Variation	[15]
High blood pressure	DISY2OHH	Strong	Biomarker	[16]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Altered Expression	[17]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[18]
Myocardial infarction	DIS655KI	Strong	Biomarker	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[20]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[21]
Obesity	DIS47Y1K	Strong	Altered Expression	[22]
Pulmonary emphysema	DIS5M7HZ	Strong	Biomarker	[23]
Skin disease	DISDW8R6	Strong	Biomarker	[24]
Stroke	DISX6UHX	Strong	Biomarker	[25]
Subarachnoid hemorrhage	DISI7I8Y	Strong	Genetic Variation	[26]
Acute myelogenous leukaemia	DISCSPTN	moderate	Biomarker	[27]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[28]
Autosomal dominant cutis laxa	DIS2180B	Supportive	Autosomal dominant	[29]
Type-1/2 diabetes	DISIUHAP	Disputed	Biomarker	[30]
Artery stenosis	DISQU4Q5	Limited	Genetic Variation	[31]
Buschke-Ollendorff syndrome	DIS9J6VP	Limited	Biomarker	[32]
Familial thoracic aortic aneurysm and aortic dissection	DIS069FB	Limited	Genetic Variation	[33]
Hypercalcaemia	DISKQ2K7	Limited	Genetic Variation	[34]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[34]
Moyamoya disease	DISO62CA	Limited	Genetic Variation	[35]
Myocardial ischemia	DISFTVXF	Limited	Biomarker	[36]
Pneumothorax	DISP86H1	Limited	Biomarker	[37]
Pseudoxanthoma elasticum	DIS8WUQG	Limited	Biomarker	[38]
Pulmonary disease	DIS6060I	Limited	Biomarker	[39]
Pulmonary fibrosis	DISQKVLA	Limited	Biomarker	[40]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ifosfamide	DMCT3I8	Approved	Elastin (ELN) increases the Arterial disorder ADR of Ifosfamide.	[53]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Elastin (ELN).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Elastin (ELN).	[42]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Elastin (ELN).	[43]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Elastin (ELN).	[44]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Elastin (ELN).	[45]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Elastin (ELN).	[46]
Palbociclib	DMD7L94	Approved	Palbociclib increases the expression of Elastin (ELN).	[11]
Etretinate	DM2CZFA	Approved	Etretinate increases the expression of Elastin (ELN).	[48]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Elastin (ELN).	[51]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Elastin (ELN).	[52]
Purvalanol A	DMNQ7TM	Investigative	Purvalanol A decreases the expression of Elastin (ELN).	[11]
CVT-313	DMSEK5W	Investigative	CVT-313 decreases the expression of Elastin (ELN).	[11]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Penicillamine	DM40EF6	Approved	Penicillamine affects the localization of Elastin (ELN).	[49]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Elastin (ELN).	[50]

References

• [1] Mechanisms underlying the inhibitory effects of probucol on elastase-induced abdominal aortic aneurysm in mice.Br J Pharmacol. 2020 Jan;177(1):204-216. doi: 10.1111/bph.14857. Epub 2019 Nov 3.
• [2] Long-term Surgical Prognosis of Primary Supravalvular Aortic Stenosis Repair.Ann Thorac Surg. 2019 Oct;108(4):1202-1209. doi: 10.1016/j.athoracsur.2019.04.094. Epub 2019 Jun 20.
• [3] New insights into the pathogenesis of autosomal-dominant cutis laxa with report of five ELN mutations. Hum Mutat. 2011 Apr;32(4):445-55. doi: 10.1002/humu.21462. Epub 2011 Mar 1.
• [4] Anatomically specific reactive oxygen species production participates in Marfan syndrome aneurysm formation.J Cell Mol Med. 2019 Oct;23(10):7000-7009. doi: 10.1111/jcmm.14587. Epub 2019 Aug 11.
• [5] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [6] Mesenchymal stem cell-derived conditioned medium attenuate angiotensin II-induced aortic aneurysm growth by modulating macrophage polarization.J Cell Mol Med. 2019 Dec;23(12):8233-8245. doi: 10.1111/jcmm.14694. Epub 2019 Oct 4.
• [7] Fractal dimension and directional analysis of elastic and collagen fiber arrangement in unsectioned arterial tissues affected by atherosclerosis and aging.J Appl Physiol (1985). 2019 Mar 1;126(3):638-646. doi: 10.1152/japplphysiol.00497.2018. Epub 2019 Jan 10.
• [8] Smaller and larger deletions of the Williams Beuren syndrome region implicate genes involved in mild facial phenotype, epilepsy and autistic traits.Eur J Hum Genet. 2014 Jan;22(1):64-70. doi: 10.1038/ejhg.2013.101. Epub 2013 Jun 12.
• [9] Aortic stiffness is associated with vascular calcification and remodeling in a chronic kidney disease rat model.Am J Physiol Renal Physiol. 2011 Jun;300(6):F1431-6. doi: 10.1152/ajprenal.00079.2011. Epub 2011 Apr 6.
• [10] Role of elastin peptides and elastin receptor complex in metabolic and cardiovascular diseases.FEBS J. 2019 Aug;286(15):2980-2993. doi: 10.1111/febs.14836. Epub 2019 Apr 11.
• [11] Retinoblastoma protein modulates the inverse relationship between cellular proliferation and elastogenesis. J Biol Chem. 2011 Oct 21;286(42):36580-91. doi: 10.1074/jbc.M111.269944. Epub 2011 Aug 31.
• [12] A Genetic Investigation of the Well-Being Spectrum.Behav Genet. 2019 May;49(3):286-297. doi: 10.1007/s10519-019-09951-0. Epub 2019 Feb 27.
• [13] Facioscapulohumeral muscular dystrophy (FSHD) myoblasts demonstrate increased susceptibility to oxidative stress.Neuromuscul Disord. 2003 May;13(4):322-33. doi: 10.1016/s0960-8966(02)00284-5.
• [14] Impact of diet on the persistence of early vascular remodeling and stiffening induced by intrauterine growth restriction and a maternal high-fat diet.Am J Physiol Heart Circ Physiol. 2019 Aug 1;317(2):H424-H433. doi: 10.1152/ajpheart.00127.2019. Epub 2019 Jun 21.
• [15] Lack of association of polymorphisms in elastin with pseudoexfoliation syndrome and glaucoma.J Glaucoma. 2010 Sep;19(7):432-6. doi: 10.1097/IJG.0b013e3181c4b0fe.
• [16] Minoxidil versus placebo in the treatment of arterial wall hypertrophy in children with Williams Beuren Syndrome: a randomized controlled trial.BMC Pediatr. 2019 May 28;19(1):170. doi: 10.1186/s12887-019-1544-1.
• [17] Microarray gene expression profiles in dilated and hypertrophic cardiomyopathic end-stage heart failure.Physiol Genomics. 2002 Jul 12;10(1):31-44. doi: 10.1152/physiolgenomics.00122.2001.
• [18] Inhibition of lysyl oxidase-like 1 (LOXL1) expression arrests liver fibrosis progression in cirrhosis by reducing elastin crosslinking.Biochim Biophys Acta Mol Basis Dis. 2018 Apr;1864(4 Pt A):1129-1137. doi: 10.1016/j.bbadis.2018.01.019. Epub 2018 Jan 31.
• [19] Simultaneous Assessment of Cardiac Inflammation and Extracellular Matrix Remodeling after Myocardial Infarction.Circ Cardiovasc Imaging. 2018 Nov;11(11):e007453. doi: 10.1161/CIRCIMAGING.117.007453. Epub 2018 Nov 15.
• [20] Prognostic significance of venous invasion in node-negative head and neck squamous cell carcinoma.J Oral Pathol Med. 2020 Feb;49(2):150-155. doi: 10.1111/jop.12975. Epub 2019 Dec 1.
• [21] Hydrogen Sulfide Prevents Elastin Loss and Attenuates Calcification Induced by High Glucose in Smooth Muscle Cells through Suppression of Stat3/Cathepsin S Signaling Pathway.Int J Mol Sci. 2019 Aug 27;20(17):4202. doi: 10.3390/ijms20174202.
• [22] Reduction and fragmentation of elastic fibers in the skin of obese mice is associated with altered mRNA expression levels of fibrillin-1 and neprilysin.Connect Tissue Res. 2017 Sep;58(5):479-486. doi: 10.1080/03008207.2016.1255205. Epub 2016 Nov 28.
• [23] Impact of aging on inflammatory and immune responses during elastin peptide-induced murine emphysema.Am J Physiol Lung Cell Mol Physiol. 2019 Apr 1;316(4):L608-L620. doi: 10.1152/ajplung.00402.2018. Epub 2019 Jan 24.
• [24] A case of paraneoplastic elastosis perforans serpiginosa associated with ovarian malignancy.Int J Dermatol. 2018 Apr;57(4):470-472. doi: 10.1111/ijd.13854. Epub 2018 Jan 22.
• [25] Subarachnoid hemorrhage: tests of association with apolipoprotein E and elastin genes.BMC Med Genet. 2007 Jul 31;8:49. doi: 10.1186/1471-2350-8-49.
• [26] Association of polymorphisms in the elastin gene with sporadic ruptured intracranial aneurysms and unruptured intracranial aneurysms in Chinese patients.Int J Neurosci. 2013 Jul;123(7):454-8. doi: 10.3109/00207454.2013.763803. Epub 2013 Feb 6.
• [27] Ring sideroblasts in AML are associated with adverse risk characteristics and have a distinct gene expression pattern.Blood Adv. 2019 Oct 22;3(20):3111-3122. doi: 10.1182/bloodadvances.2019000518.
• [28] Elastin-Specific Autoimmunity in Smokers With Thoracic Aortic Aneurysm and Dissection is Independent of Chronic Obstructive Pulmonary Disease.J Am Heart Assoc. 2019 Apr 16;8(8):e011671. doi: 10.1161/JAHA.118.011671.
• [29] Aortic aneurysmal disease and cutis laxa caused by defects in the elastin gene. J Med Genet. 2006 Mar;43(3):255-8. doi: 10.1136/jmg.2005.034157. Epub 2005 Aug 5.
• [30] Expression levels of cathepsin L and cystatin C in a hyperglycemic environment were associated with aortic aneurysm development in a mouse model.J Int Med Res. 2019 Jun;47(6):2499-2506. doi: 10.1177/0300060519847880. Epub 2019 May 17.
• [31] Spontaneous development and rupture of pulmonary artery aneurysm: a rare complication in an infant with peripheral pulmonary artery stenoses due to mutation of the elastin gene.Pediatr Cardiol. 2008 Mar;29(2):438-41. doi: 10.1007/s00246-007-9096-9. Epub 2007 Oct 3.
• [32] Deactivating germline mutations in LEMD3 cause osteopoikilosis and Buschke-Ollendorff syndrome, but not sporadic melorheostosis.J Bone Miner Res. 2007 Feb;22(2):243-50. doi: 10.1359/jbmr.061102.
• [33] ELN gene triplication responsible for familial supravalvular aortic aneurysm.Cardiol Young. 2015 Apr;25(4):712-7. doi: 10.1017/S1047951114000766. Epub 2014 Jun 16.
• [34] Delineation of the common critical region in Williams syndrome and clinical correlation of growth, heart defects, ethnicity, and parental origin.Am J Med Genet. 1998 Jun 16;78(1):82-9. doi: 10.1002/(sici)1096-8628(19980616)78:1<82::aid-ajmg17>3.0.co;2-k.
• [35] Moyamoya disease and artery tortuosity as rare phenotypes in a patient with an elastin mutation.Am J Med Genet A. 2016 Jul;170(7):1924-7. doi: 10.1002/ajmg.a.37662. Epub 2016 Apr 15.
• [36] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [37] Genetic and morphologic determinants of pneumothorax in lymphangioleiomyomatosis.Am J Physiol Lung Cell Mol Physiol. 2007 Sep;293(3):L800-8. doi: 10.1152/ajplung.00176.2007. Epub 2007 Jul 6.
• [38] Microscopy with ultraviolet surface excitation (MUSE): A novel approach to real-time inexpensive slide-free dermatopathology.J Cutan Pathol. 2018 Jul;45(7):498-503. doi: 10.1111/cup.13255. Epub 2018 May 8.
• [39] Reduced elastogenesis: a clue to the arteriosclerosis and emphysematous changes in Schimke immuno-osseous dysplasia?.Orphanet J Rare Dis. 2012 Sep 22;7:70. doi: 10.1186/1750-1172-7-70.
• [40] Increased circulating desmosine and age-dependent elastinolysis in idiopathic pulmonary fibrosis.Respir Res. 2018 Mar 20;19(1):45. doi: 10.1186/s12931-018-0747-6.
• [41] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [44] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [45] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [46] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [47] Retinoblastoma protein modulates the inverse relationship between cellular proliferation and elastogenesis. J Biol Chem. 2011 Oct 21;286(42):36580-91. doi: 10.1074/jbc.M111.269944. Epub 2011 Aug 31.
• [48] The effects of a novel synthetic retinoid, seletinoid G, on the expression of extracellular matrix proteins in aged human skin in vivo. Clin Chim Acta. 2005 Dec;362(1-2):161-9. doi: 10.1016/j.cccn.2005.06.016. Epub 2005 Aug 1.
• [49] Collagen and elastin changes in D-penicillamine-induced pseudoxanthoma elasticum-like skin. Br J Dermatol. 1986 Mar;114(3):381-8. doi: 10.1111/j.1365-2133.1986.tb02832.x.
• [50] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [51] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [52] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [53] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.