Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFTWMIQ)

• DOT Name: Pleckstrin homology-like domain family A member 1 (PHLDA1)
• Synonyms: Apoptosis-associated nuclear protein; Proline- and glutamine-rich protein; PQ-rich protein; PQR protein; Proline- and histidine-rich protein; T-cell death-associated gene 51 protein
• Gene Name: PHLDA1
• Related Disease:
  Allergic contact dermatitis
  Hepatocellular carcinoma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Epilepsy
  Estrogen-receptor positive breast cancer
  Glioma
  Kidney cancer
  Metastatic malignant neoplasm
  Metastatic melanoma
  Oral cancer
  Ovarian cancer
  Pancreatic tumour
  Renal carcinoma
  Atrial fibrillation
  Bone osteosarcoma
  Familial atrial fibrillation
  Melanoma
  Osteosarcoma
  Childhood kidney Wilms tumor
  Gastric cancer
  Melanocytic nevus
  Neuroblastoma
  Stomach cancer
  Wilms tumor
• UniProt ID: PHLA1_HUMAN
• Sequence:
  MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGR
  GPAARSSGTLWRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLP
  PARAAGNGEAEPSGGPSYAGRMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLL
  LIPPKQLQHQQQQQQQQQQQQQQQPGQGPAEPSQPSGPAVASLEPPVKLKELHFSNMKTV
  DCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQ
  HLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHPYPHPHPHPHS
  HPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA
• Function: Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in translational regulation.
• Tissue Specificity: Widely expressed with highest levels in pancreas. Strongly expressed by benign melanocytic nevi, and progressively reduced expressed in primary and metastatic melanomas (at protein level).
• Reactome Pathway: Interaction between PHLDA1 and AURKA (R-HSA-8854521)

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Allergic contact dermatitis	DISFFVF9	Definitive	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[4]
Epilepsy	DISBB28L	Strong	Altered Expression	[5]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Biomarker	[4]
Glioma	DIS5RPEH	Strong	Altered Expression	[6]
Kidney cancer	DISBIPKM	Strong	Biomarker	[3]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[7]
Metastatic melanoma	DISSL43L	Strong	Altered Expression	[8]
Oral cancer	DISLD42D	Strong	Biomarker	[9]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[10]
Pancreatic tumour	DIS3U0LK	Strong	Altered Expression	[8]
Renal carcinoma	DISER9XT	Strong	Biomarker	[3]
Atrial fibrillation	DIS15W6U	moderate	Biomarker	[11]
Bone osteosarcoma	DIST1004	moderate	Altered Expression	[12]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[11]
Melanoma	DIS1RRCY	moderate	Biomarker	[13]
Osteosarcoma	DISLQ7E2	moderate	Altered Expression	[12]
Childhood kidney Wilms tumor	DIS0NMK3	Limited	Altered Expression	[14]
Gastric cancer	DISXGOUK	Limited	Biomarker	[15]
Melanocytic nevus	DISYS32D	Limited	Altered Expression	[16]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[17]
Stomach cancer	DISKIJSX	Limited	Biomarker	[15]
Wilms tumor	DISB6T16	Limited	Altered Expression	[14]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	Pleckstrin homology-like domain family A member 1 (PHLDA1) affects the response to substance of DTI-015.	[62]

48 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[18]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[24]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[25]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[26]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[27]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[28]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[29]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[30]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[31]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[32]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[33]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[29]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[30]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[34]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[35]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[2]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[37]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[38]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[39]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[40]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[41]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[42]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[43]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[44]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[45]
Isoflavone	DM7U58J	Phase 4	Isoflavone affects the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[46]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[30]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[47]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[30]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[49]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[50]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[51]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[52]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[53]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[55]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[56]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[57]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[58]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[59]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[60]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Pleckstrin homology-like domain family A member 1 (PHLDA1).	[61]

References

• [1] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [2] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [3] PHLDA1 Mediates Drug Resistance in Receptor Tyrosine Kinase-Driven Cancer.Cell Rep. 2018 Feb 27;22(9):2469-2481. doi: 10.1016/j.celrep.2018.02.028.
• [4] PHLDA1 expression is controlled by an estrogen receptor-NFB-miR-181 regulatory loop and is essential for formation of ER+ mammospheres.Oncogene. 2015 Apr 30;34(18):2309-16. doi: 10.1038/onc.2014.180. Epub 2014 Jun 23.
• [5] TDAG51 in the anterior temporal neocortex of patients with intractable epilepsy.Neurosci Lett. 2007 Sep 20;425(1):53-8. doi: 10.1016/j.neulet.2007.08.016. Epub 2007 Aug 15.
• [6] The long non-coding RNA SNHG1 promotes glioma progression by competitively binding to miR-194 to regulate PHLDA1 expression.Cell Death Dis. 2019 Jun 12;10(6):463. doi: 10.1038/s41419-019-1698-7.
• [7] PHLDA1 expression marks the putative epithelial stem cells and contributes to intestinal tumorigenesis.Cancer Res. 2011 May 15;71(10):3709-19. doi: 10.1158/0008-5472.CAN-10-2342. Epub 2011 May 10.
• [8] PHLDA1 (pleckstrin homology-like domain, family A, member 1) knockdown promotes migration and invasion of MCF10A breast epithelial cells.Cell Adh Migr. 2018 Jan 2;12(1):37-46. doi: 10.1080/19336918.2017.1313382. Epub 2017 Jun 29.
• [9] Differential susceptibility to hydrogen sulfide-induced apoptosis between PHLDA1-overexpressing oral cancer cell lines and oral keratinocytes: role of PHLDA1 as an apoptosis suppressor.Exp Cell Res. 2014 Jan 15;320(2):247-57. doi: 10.1016/j.yexcr.2013.10.023. Epub 2013 Nov 20.
• [10] PHLDA1, another PHLDA family protein that inhibits Akt.Cancer Sci. 2018 Nov;109(11):3532-3542. doi: 10.1111/cas.13796. Epub 2018 Oct 13.
• [11] Biobank-driven genomic discovery yields new insight into atrial fibrillation biology.Nat Genet. 2018 Sep;50(9):1234-1239. doi: 10.1038/s41588-018-0171-3. Epub 2018 Jul 30.
• [12] Characterization of the metastatic phenotype of a panel of established osteosarcoma cells.Oncotarget. 2015 Oct 6;6(30):29469-81. doi: 10.18632/oncotarget.5177.
• [13] TDAG51 is an ERK signaling target that opposes ERK-mediated HME16C mammary epithelial cell transformation.BMC Cancer. 2008 Jul 2;8:189. doi: 10.1186/1471-2407-8-189.
• [14] Abnormal RNA expression of 11p15 imprinted genes and kidney developmental genes in Wilms' tumor.Cancer Res. 2000 Mar 15;60(6):1521-5.
• [15] Circ_0027599/PHDLA1 suppresses gastric cancer progression by sponging miR-101-3p.1.Cell Biosci. 2018 Nov 6;8:58. doi: 10.1186/s13578-018-0252-0. eCollection 2018.
• [16] Identification of the human PHLDA1/TDAG51 gene: down-regulation in metastatic melanoma contributes to apoptosis resistance and growth deregulation.Cancer Res. 2002 Oct 15;62(20):5920-9.
• [17] Downregulation of the PHLDA1 gene in IMR-32 neuroblastoma cells increases levels of AuroraA, TRKB and affects proteins involved in apoptosis and autophagy pathways.Int J Oncol. 2016 Aug;49(2):823-37. doi: 10.3892/ijo.2016.3572. Epub 2016 Jun 8.
• [18] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [19] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [20] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [21] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [22] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [25] Transcriptional responses to estrogen and progesterone in mammary gland identify networks regulating p53 activity. Endocrinology. 2008 Oct;149(10):4809-20. doi: 10.1210/en.2008-0035. Epub 2008 Jun 12.
• [26] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [27] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [28] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [29] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [30] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [31] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [32] A genome-wide screen for promoter methylation in lung cancer identifies novel methylation markers for multiple malignancies. PLoS Med. 2006 Dec;3(12):e486. doi: 10.1371/journal.pmed.0030486.
• [33] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [34] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [35] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [36] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [37] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [38] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [39] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [40] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [41] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [42] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [43] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [44] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [45] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [46] Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
• [47] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [48] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [49] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [50] Highly active combination of BRD4 antagonist and histone deacetylase inhibitor against human acute myelogenous leukemia cells. Mol Cancer Ther. 2014 May;13(5):1142-54.
• [51] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [52] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [53] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [54] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [55] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [56] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [57] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [58] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [59] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [60] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [61] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [62] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.