Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHNNVSG)

• DOT Name: Fibroblast growth factor 13 (FGF13)
• Synonyms: FGF-13; Fibroblast growth factor homologous factor 2; FHF-2
• Gene Name: FGF13
• Related Disease:
  Epilepsy
  Adenoma
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Bladder cancer
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Carcinoma of esophagus
  Developmental and epileptic encephalopathy, 90
  Esophageal cancer
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Neoplasm
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Obesity
  Osteosarcoma
  Pancreatic tumour
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Rheumatoid arthritis
  Stomach cancer
  Type-1/2 diabetes
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adenocarcinoma
  Diabetic kidney disease
  Epithelial ovarian cancer
  Esophageal adenocarcinoma
  Squamous cell carcinoma
  Undetermined early-onset epileptic encephalopathy
  Acute myelogenous leukaemia
  Chronic kidney disease
  Colorectal carcinoma
  Metastatic malignant neoplasm
  Neuroblastoma
  Pancreatic cancer
  Parkinson disease
• UniProt ID: FGF13_HUMAN
• PDB ID: 3HBW; 4DCK; 4JPZ
• Pfam ID: PF00167
• Sequence:
  MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRR
  RPEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK
  LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIM
  KGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS
  HNEST
• Function: Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate in the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. Regulates voltage-gated sodium channel transport and function. May also play a role in MAPK signaling. Required for the development of axonal initial segment-targeting inhibitory GABAergic synapses made by chandelier neurons.
• Tissue Specificity: Ubiquitously expressed. Predominantly expressed in the nervous system.
• Reactome Pathway: Phase 0 - rapid depolarisation (R-HSA-5576892)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epilepsy	DISBB28L	Definitive	Biomarker	[1]
Adenoma	DIS78ZEV	Strong	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Bladder cancer	DISUHNM0	Strong	Biomarker	[4]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[4]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[10]
Developmental and epileptic encephalopathy, 90	DISV1FBX	Strong	X-linked	[11]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[10]
Gastric cancer	DISXGOUK	Strong	Biomarker	[12]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[3]
Glioma	DIS5RPEH	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Lung cancer	DISCM4YA	Strong	Altered Expression	[15]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[15]
Neoplasm	DISZKGEW	Strong	Biomarker	[8]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[10]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[16]
Obesity	DIS47Y1K	Strong	Biomarker	[17]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[7]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[18]
Prostate cancer	DISF190Y	Strong	Biomarker	[19]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[20]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[21]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[12]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[22]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[4]
Adenocarcinoma	DIS3IHTY	moderate	Altered Expression	[23]
Diabetic kidney disease	DISJMWEY	moderate	Biomarker	[24]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[25]
Esophageal adenocarcinoma	DISODWFP	moderate	Biomarker	[26]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[27]
Undetermined early-onset epileptic encephalopathy	DISISEI2	Supportive	Autosomal dominant	[28]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[29]
Chronic kidney disease	DISW82R7	Limited	Biomarker	[30]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[31]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[32]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[33]
Pancreatic cancer	DISJC981	Limited	Biomarker	[34]
Parkinson disease	DISQVHKL	Limited	Biomarker	[35]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Fibroblast growth factor 13 (FGF13) decreases the response to substance of Cisplatin.	[50]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Fibroblast growth factor 13 (FGF13).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Fibroblast growth factor 13 (FGF13).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Fibroblast growth factor 13 (FGF13).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Fibroblast growth factor 13 (FGF13).	[39]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Fibroblast growth factor 13 (FGF13).	[42]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Fibroblast growth factor 13 (FGF13).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Fibroblast growth factor 13 (FGF13).	[45]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Fibroblast growth factor 13 (FGF13).	[46]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Fibroblast growth factor 13 (FGF13).	[47]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Fibroblast growth factor 13 (FGF13).	[48]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR decreases the expression of Fibroblast growth factor 13 (FGF13).	[49]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Fibroblast growth factor 13 (FGF13).	[40]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Fibroblast growth factor 13 (FGF13).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Fibroblast growth factor 13 (FGF13).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Fibroblast growth factor 13 (FGF13).	[41]

References

• [1] Is FGF13 a major contributor to genetic epilepsy with febrile seizures plus?.Epilepsy Res. 2016 Dec;128:48-51. doi: 10.1016/j.eplepsyres.2016.10.008. Epub 2016 Oct 25.
• [2] Invasive giant prolactinoma with loss of therapeutic response to cabergoline: expression of angiogenic markers.Endocr Pathol. 2009 Spring;20(1):35-40. doi: 10.1007/s12022-009-9057-3.
• [3] Fibroblast growth factor 13 regulates glioma cell invasion and is important for bevacizumab-induced glioma invasion.Oncogene. 2018 Feb 8;37(6):777-786. doi: 10.1038/onc.2017.373. Epub 2017 Oct 23.
• [4] Analyses of publicly available genomics resources define FGF-2-expressing bladder carcinomas as EMT-prone, proliferative tumors with low mutation rates and high expression of CTLA-4, PD-1 and PD-L1.Signal Transduct Target Ther. 2017;2:16045-. doi: 10.1038/sigtrans.2016.45. Epub 2017 Mar 17.
• [5] Glycosaminoglycans from Alzheimer's disease hippocampus have altered capacities to bind and regulate growth factors activities and to bind tau.PLoS One. 2019 Jan 4;14(1):e0209573. doi: 10.1371/journal.pone.0209573. eCollection 2019.
• [6] Knockout of Low Molecular Weight FGF2 Attenuates Atherosclerosis by Reducing Macrophage Infiltration and Oxidative Stress in Mice.Cell Physiol Biochem. 2018;45(4):1434-1443. doi: 10.1159/000487569. Epub 2018 Feb 16.
• [7] Parathyroid hormone affects the fibroblast growth factor-proteoglycan signaling axis to regulate osteosarcoma cell migration.FEBS J. 2011 Oct;278(19):3782-92. doi: 10.1111/j.1742-4658.2011.08300.x. Epub 2011 Sep 8.
• [8] E2F1 Drives Breast Cancer Metastasis by Regulating the Target Gene FGF13 and Altering Cell Migration.Sci Rep. 2019 Jul 24;9(1):10718. doi: 10.1038/s41598-019-47218-0.
• [9] Carcinoma-associated fibroblasts activate progesterone receptors and induce hormone independent mammary tumor growth: A role for the FGF-2/FGFR-2 axis.Int J Cancer. 2008 Dec 1;123(11):2518-31. doi: 10.1002/ijc.23802.
• [10] NCAM- and FGF-2-mediated FGFR1 signaling in the tumor microenvironment of esophageal cancer regulates the survival and migration of tumor-associated macrophages and cancer cells.Cancer Lett. 2016 Sep 28;380(1):47-58. doi: 10.1016/j.canlet.2016.06.009. Epub 2016 Jun 15.
• [11] Xq26.3 microdeletion in a male with Wildervanck Syndrome. Ophthalmic Genet. 2014 Mar;35(1):18-24. doi: 10.3109/13816810.2013.766218. Epub 2013 Feb 1.
• [12] Expression of fibroblast growth factor 2 mRNA in early and advanced gastric cancer.Acta Oncol. 1997;36(7):695-700. doi: 10.3109/02841869709001339.
• [13] Inhibition of COX-2, mPGES-1 and CYP4A by isoliquiritigenin blocks the angiogenic Akt signaling in glioma through ceRNA effect of miR-194-5p and lncRNA NEAT1.J Exp Clin Cancer Res. 2019 Aug 22;38(1):371. doi: 10.1186/s13046-019-1361-2.
• [14] An adiponectin receptor, T-cadherin, was selectively expressed in intratumoral capillary endothelial cells in hepatocellular carcinoma: possible cross talk between T-cadherin and FGF-2 pathways.Virchows Arch. 2006 Mar;448(3):311-8. doi: 10.1007/s00428-005-0098-9. Epub 2005 Nov 5.
• [15] Anti-tumor angiogenesis therapy using soluble receptors: enhanced inhibition of tumor growth when soluble fibroblast growth factor receptor-1 is used with soluble vascular endothelial growth factor receptor.Cancer Gene Ther. 2002 Aug;9(8):633-40. doi: 10.1038/sj.cgt.7700478.
• [16] S6K2 promises an important therapeutic potential for cancer.Future Oncol. 2019 Jan;15(1):95-102. doi: 10.2217/fon-2018-0332. Epub 2018 Nov 1.
• [17] Childhood Obesity, Genetic Variation, and Dental Age.Pediatr Dent. 2019 Mar 15;41(2):132-135.
• [18] Pancreatic endocrine tumors: expression profiling evidences a role for AKT-mTOR pathway.J Clin Oncol. 2010 Jan 10;28(2):245-55. doi: 10.1200/JCO.2008.21.5988. Epub 2009 Nov 16.
• [19] FGF-2 is a driving force for chromosomal instability and a stromal factor associated with adverse clinico-pathological features in prostate cancer.Urol Oncol. 2018 Aug;36(8):365.e15-365.e26. doi: 10.1016/j.urolonc.2018.05.020. Epub 2018 Jun 7.
• [20] Fibroblast growth factor and ornithine decarboxylase 5'UTRs enable preferential expression in human prostate cancer cells and in prostate tumors of PTEN(-/-) transgenic mice.Cancer Gene Ther. 2012 Jan;19(1):19-29. doi: 10.1038/cgt.2011.62. Epub 2011 Sep 16.
• [21] A mutation in a CD44 variant of inflammatory cells enhances the mitogenic interaction of FGF with its receptor.J Clin Invest. 2003 Apr;111(8):1211-20. doi: 10.1172/JCI17100.
• [22] Growth factors and the regulation of fetal growth.Diabetes Care. 1998 Aug;21 Suppl 2:B60-9.
• [23] Alternative splicing of the FGF antisense gene: differential subcellular localization in human tissues and esophageal adenocarcinoma.J Mol Med (Berl). 2007 Nov;85(11):1215-28. doi: 10.1007/s00109-007-0219-9. Epub 2007 Jun 14.
• [24] Heparanase is a key player in renal fibrosis by regulating TGF- expression and activity.Biochim Biophys Acta. 2014 Sep;1843(9):2122-8. doi: 10.1016/j.bbamcr.2014.06.005. Epub 2014 Jun 15.
• [25] From gene profiling to diagnostic markers: IL-18 and FGF-2 complement CA125 as serum-based markers in epithelial ovarian cancer.Int J Cancer. 2006 Apr 1;118(7):1750-8. doi: 10.1002/ijc.21521.
• [26] Regulation of FGF-2 by an endogenous antisense RNA: effects on cell adhesion and cell-cycle progression.Mol Carcinog. 2010 Dec;49(12):1031-44. doi: 10.1002/mc.20686.
• [27] Fibroblast Growth Factor (FGF-2) and Its Receptors FGFR-2 and FGFR-3 May Be Putative Biomarkers of Malignant Transformation of Potentially Malignant Oral Lesions into Oral Squamous Cell Carcinoma.PLoS One. 2015 Oct 14;10(10):e0138801. doi: 10.1371/journal.pone.0138801. eCollection 2015.
• [28] Missense variants in the N-terminal domain of the A isoform of FHF2/FGF13 cause an X-linked developmental and epileptic encephalopathy. Am J Hum Genet. 2021 Jan 7;108(1):176-185. doi: 10.1016/j.ajhg.2020.10.017. Epub 2020 Nov 26.
• [29] Activation of FGFR1beta signaling pathway promotes survival, migration and resistance to chemotherapy in acute myeloid leukemia cells.Leukemia. 2006 Jun;20(6):979-86. doi: 10.1038/sj.leu.2404203.
• [30] Arterial tissue transcriptional profiles associate with tissue remodeling and cardiovascular phenotype in children with end-stage kidney disease.Sci Rep. 2019 Jul 16;9(1):10316. doi: 10.1038/s41598-019-46805-5.
• [31] MiR-10b suppresses the growth and metastasis of colorectal cancer cell by targeting FGF13.Eur Rev Med Pharmacol Sci. 2019 Jan;23(2):576-587. doi: 10.26355/eurrev_201901_16870.
• [32] Change in FGF-2 circulating levels after arterial embolization in patients with bone metastases.Neoplasma. 2018;65(2):262-268. doi: 10.4149/neo_2018_170204N74.
• [33] Induction of Id-1 by FGF-2 involves activity of EGR-1 and sensitizes neuroblastoma cells to cell death.J Cell Physiol. 2011 Jul;226(7):1763-70. doi: 10.1002/jcp.22505.
• [34] Increased fibrosis and impaired intratumoral accumulation of macromolecules in a murine model of pancreatic cancer co-administered with FGF-2.J Control Release. 2016 May 28;230:109-15. doi: 10.1016/j.jconrel.2016.04.007. Epub 2016 Apr 12.
• [35] Neurotrophic support of midbrain dopaminergic neurons.Adv Exp Med Biol. 2009;651:73-80. doi: 10.1007/978-1-4419-0322-8_7.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [38] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [39] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [40] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [41] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [42] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [43] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [44] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] The genome-wide expression profile of Scrophularia ningpoensis-treated thapsigargin-stimulated U-87MG cells. Neurotoxicology. 2009 May;30(3):368-76.
• [47] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [48] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [49] Gene expression network regulated by DNA methylation and microRNA during microcystin-leucine arginine induced malignant transformation in human hepatocyte L02 cells. Toxicol Lett. 2018 Jun 1;289:42-53. doi: 10.1016/j.toxlet.2018.03.003. Epub 2018 Mar 5.
• [50] Upregulated expression of FGF13/FHF2 mediates resistance to platinum drugs in cervical cancer cells. Sci Rep. 2013 Oct 11;3:2899. doi: 10.1038/srep02899.