Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIIGGZ2)

DOT Name	Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A)
Synonyms	Ubiquitin carboxyl extension protein 80
Gene Name	RPS27A
Related Disease	Acute leukaemia ( ) Al amyloidosis ( ) Atrial fibrillation ( ) Breast cancer ( ) Breast carcinoma ( ) Carcinoma ( ) Cognitive impairment ( ) Colon cancer ( ) Colon carcinoma ( ) Cystic fibrosis ( ) Diabetic kidney disease ( ) Diamond-Blackfan anemia ( ) Epidermolysis bullosa ( ) Epilepsy ( ) Glomerulonephritis ( ) Head and neck cancer ( ) Head and neck carcinoma ( ) Hepatitis C virus infection ( ) Hepatocellular carcinoma ( ) Liver cirrhosis ( ) Multiple symmetric lipomatosis ( ) Neoplasm ( ) Neuroblastic tumor ( ) Non-small-cell lung cancer ( ) Pancreas disorder ( ) Parkinson disease ( ) Plasma cell myeloma ( ) Prostate cancer ( ) Prostate carcinoma ( ) Prostate neoplasm ( ) Retinoblastoma ( ) Retinopathy ( ) Seminoma ( ) Systemic lupus erythematosus ( ) Lymphoma ( ) Amyotrophic lateral sclerosis ( ) Colorectal carcinoma ( ) Lewy body dementia ( ) Nasopharyngeal carcinoma ( ) Pancreatic cancer ( ) Sandhoff disease ( )
UniProt ID	RS27A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2KHW ; 2KOX ; 2KTF ; 2KWU ; 2KWV ; 2L0F ; 2L0T ; 2XK5 ; 3AXC ; 3I3T ; 3K9P ; 3N30 ; 3N32 ; 3NHE ; 3NOB ; 3NS8 ; 3PHD ; 3PHW ; 3TBL ; 3VDZ ; 4R62 ; 4UG0 ; 4V6X ; 5A2Q ; 5AJ0 ; 5FLX ; 5LKS ; 5T2C ; 5WVO ; 5YDK ; 6DC6 ; 6FEC ; 6G18 ; 6G51 ; 6G53 ; 6G5H ; 6G5I ; 6IP5 ; 6IP6 ; 6IP8 ; 6J99 ; 6KFP ; 6KG6 ; 6KIU ; 6KIV ; 6KIW ; 6OLE ; 6OLF ; 6OLG ; 6OLI ; 6OLZ ; 6OM0 ; 6OM7 ; 6QZP ; 6SQO ; 6SQR ; 6SQS ; 6XA1 ; 6Y0G ; 6Y57 ; 6YBS ; 6Z6L ; 6Z6M ; 6Z6N ; 6ZLW ; 6ZM7 ; 6ZME ; 6ZMI ; 6ZMO ; 6ZMT ; 6ZMW ; 6ZN5 ; 6ZOJ ; 6ZOL ; 6ZON ; 6ZP4 ; 6ZUO ; 6ZV6 ; 6ZVH ; 6ZVJ ; 6ZXD ; 6ZXE ; 6ZXF ; 6ZXG ; 6ZXH ; 7A09 ; 7BWD ; 7F0N ; 7JQB ; 7JQC ; 7K5I ; 7MQ9 ; 7MQA ; 7OOJ ; 7QP6 ; 7QP7 ; 7R4X ; 7TQL ; 7WTT ; 7WTU ; 7WTV ; 7WTW ; 7WTX ; 7WTZ ; 7WU0 ; 7XNY ; 8G5Y ; 8G60 ; 8G61 ; 8G6J ; 8GLP ; 8PPK ; 8PPL ; 8T4S
Pfam ID	PF01599 ; PF00240
Sequence	MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Function	[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in proteotoxic stress response and cell cycle; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling; [Small ribosomal subunit protein eS31]: Component of the 40S subunit of the ribosome. Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome.
KEGG Pathway	Ribosome (hsa03010 ) Ubiquitin mediated proteolysis (hsa04120 ) Mitophagy - animal (hsa04137 ) Autophagy - animal (hsa04140 ) Parkinson disease (hsa05012 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Shigellosis (hsa05131 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Coro.virus disease - COVID-19 (hsa05171 )
Reactome Pathway	Recognition of DNA damage by PCNA-containing replication complex (R-HSA-110314 ) Translesion Synthesis by POLH (R-HSA-110320 ) Activation of NF-kappaB in B cells (R-HSA-1169091 ) ISG15 antiviral mechanism (R-HSA-1169408 ) Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176 ) Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants (R-HSA-1236382 ) ER-Phagosome pathway (R-HSA-1236974 ) Downregulation of ERBB4 signaling (R-HSA-1253288 ) Spry regulation of FGF signaling (R-HSA-1295596 ) Downregulation of ERBB2 (R-HSA-1358803 ) L13a-mediated translational silencing of Ceruloplasmin expression (R-HSA-156827 ) Peptide chain elongation (R-HSA-156902 ) Budding and maturation of HIV virion (R-HSA-162588 ) NOD1/2 Signaling Pathway (R-HSA-168638 ) TICAM1, RIP1-mediated IKK complex recruitment (R-HSA-168927 ) DDX58/IFIH1-mediated induction of interferon-alpha/beta (R-HSA-168928 ) APC/C (R-HSA-174048 ) Autodegradation of Cdh1 by Cdh1 (R-HSA-174084 ) SCF-beta-TrCP mediated degradation of Emi1 (R-HSA-174113 ) APC/C (R-HSA-174154 ) APC/C (R-HSA-174178 ) Cdc20 (R-HSA-174184 ) Membrane binding and targetting of GAG proteins (R-HSA-174490 ) Assembly Of The HIV Virion (R-HSA-175474 ) APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409 ) SRP-dependent cotranslational protein targeting to membrane (R-HSA-1799339 ) Vpu mediated degradation of CD4 (R-HSA-180534 ) Vif-mediated degradation of APOBEC3G (R-HSA-180585 ) EGFR downregulation (R-HSA-182971 ) SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577 ) Viral mRNA Translation (R-HSA-192823 ) Degradation of beta-catenin by the destruction complex (R-HSA-195253 ) TCF dependent signaling in response to WNT (R-HSA-201681 ) Downstream TCR signaling (R-HSA-202424 ) NRIF signals cell death from the nucleus (R-HSA-205043 ) p75NTR recruits signalling complexes (R-HSA-209543 ) NF-kB is activated and signals survival (R-HSA-209560 ) Regulation of activated PAK-2p34 by proteasome mediated degradation (R-HSA-211733 ) NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947 ) Activated NOTCH1 Transmits Signal to the Nucleus (R-HSA-2122948 ) Downregulation of TGF-beta receptor signaling (R-HSA-2173788 ) TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) (R-HSA-2173791 ) Downregulation of SMAD2/3 (R-HSA-2173795 ) SMAD2/SMAD3 (R-HSA-2173796 ) Selenocysteine synthesis (R-HSA-2408557 ) Separation of Sister Chromatids (R-HSA-2467813 ) Oxidative Stress Induced Senescence (R-HSA-2559580 ) Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 ) Oncogene Induced Senescence (R-HSA-2559585 ) Regulation of PLK1 Activity at G2/M Transition (R-HSA-2565942 ) Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606 ) Stimuli-sensing channels (R-HSA-2672351 ) Constitutive Signaling by NOTCH1 HD Domain Mutants (R-HSA-2691232 ) FCERI mediated NF-kB activation (R-HSA-2871837 ) Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862 ) NOTCH2 Activation and Transmission of Signal to the Nucleus (R-HSA-2979096 ) Regulation of innate immune responses to cytosolic DNA (R-HSA-3134975 ) Glycogen synthesis (R-HSA-3322077 ) Autodegradation of the E3 ubiquitin ligase COP1 (R-HSA-349425 ) Deactivation of the beta-catenin transactivating complex (R-HSA-3769402 ) Myoclonic epilepsy of Lafora (R-HSA-3785653 ) ABC-family proteins mediated transport (R-HSA-382556 ) Circadian Clock (R-HSA-400253 ) TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989 ) activated TAK1 mediates p38 MAPK activation (R-HSA-450302 ) JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (R-HSA-450321 ) AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408 ) Asymmetric localization of PCP proteins (R-HSA-4608870 ) Degradation of AXIN (R-HSA-4641257 ) Degradation of DVL (R-HSA-4641258 ) Regulation of FZD by ubiquitination (R-HSA-4641263 ) PINK1-PRKN Mediated Mitophagy (R-HSA-5205685 ) N-glycan trimming in the ER and Calnexin/Calreticulin cycle (R-HSA-532668 ) Regulation of TNFR1 signaling (R-HSA-5357905 ) TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 ) Hedgehog ligand biogenesis (R-HSA-5358346 ) Hh mutants are degraded by ERAD (R-HSA-5362768 ) Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761 ) CLEC7A (Dectin-1) signaling (R-HSA-5607764 ) Degradation of GLI1 by the proteasome (R-HSA-5610780 ) Degradation of GLI2 by the proteasome (R-HSA-5610783 ) GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785 ) Hedgehog 'on' state (R-HSA-5632684 ) Negative regulation of FGFR1 signaling (R-HSA-5654726 ) Negative regulation of FGFR2 signaling (R-HSA-5654727 ) Negative regulation of FGFR3 signaling (R-HSA-5654732 ) Negative regulation of FGFR4 signaling (R-HSA-5654733 ) Translesion synthesis by POLK (R-HSA-5655862 ) Translesion synthesis by POLI (R-HSA-5656121 ) Termination of translesion DNA synthesis (R-HSA-5656169 ) Regulation of RAS by GAPs (R-HSA-5658442 ) TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 ) Negative regulation of MAPK pathway (R-HSA-5675221 ) Regulation of necroptotic cell death (R-HSA-5675482 ) NIK-->noncanonical NF-kB signaling (R-HSA-5676590 ) Defective CFTR causes cystic fibrosis (R-HSA-5678895 ) MAP3K8 (TPL2)-dependent MAPK1/3 activation (R-HSA-5684264 ) HDR through Homologous Recombination (HRR) (R-HSA-5685942 ) MAPK6/MAPK4 signaling (R-HSA-5687128 ) UCH proteinases (R-HSA-5689603 ) Josephin domain DUBs (R-HSA-5689877 ) Ub-specific processing proteases (R-HSA-5689880 ) Ovarian tumor domain proteases (R-HSA-5689896 ) Metalloprotease DUBs (R-HSA-5689901 ) Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565 ) Processing of DNA double-strand break ends (R-HSA-5693607 ) DNA Damage Recognition in GG-NER (R-HSA-5696394 ) Formation of Incision Complex in GG-NER (R-HSA-5696395 ) Gap-filling DNA repair synthesis and ligation in GG-NER (R-HSA-5696397 ) Dual Incision in GG-NER (R-HSA-5696400 ) Formation of TC-NER Pre-Incision Complex (R-HSA-6781823 ) Transcription-Coupled Nucleotide Excision Repair (TC-NER) (R-HSA-6781827 ) Dual incision in TC-NER (R-HSA-6782135 ) Gap-filling DNA repair synthesis and ligation in TC-NER (R-HSA-6782210 ) Fanconi Anemia Pathway (R-HSA-6783310 ) Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 ) Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756 ) Regulation of TP53 Degradation (R-HSA-6804757 ) Regulation of TP53 Activity through Methylation (R-HSA-6804760 ) Negative regulation of MET activity (R-HSA-6807004 ) Assembly of the pre-replicative complex (R-HSA-68867 ) Orc1 removal from chromatin (R-HSA-68949 ) CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017 ) Cyclin D associated events in G1 (R-HSA-69231 ) G2/M Checkpoints (R-HSA-69481 ) Stabilization of p53 (R-HSA-69541 ) Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (R-HSA-69601 ) Translation initiation complex formation (R-HSA-72649 ) Formation of a pool of free 40S subunits (R-HSA-72689 ) Formation of the ternary complex, and subsequently, the 43S complex (R-HSA-72695 ) Ribosomal scanning and start codon recognition (R-HSA-72702 ) GTP hydrolysis and joining of the 60S ribosomal subunit (R-HSA-72706 ) Eukaryotic Translation Termination (R-HSA-72764 ) Ubiquitin-dependent degradation of Cyclin D (R-HSA-75815 ) PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1 (R-HSA-8849469 ) The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 ) FBXL7 down-regulates AURKA during mitotic entry and in early mitosis (R-HSA-8854050 ) Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 ) Clathrin-mediated endocytosis (R-HSA-8856828 ) Downregulation of ERBB2 signaling (R-HSA-8863795 ) VLDLR internalisation and degradation (R-HSA-8866427 ) Synthesis of active ubiquitin (R-HSA-8866652 ) E3 ubiquitin ligases ubiquitinate target proteins (R-HSA-8866654 ) InlB-mediated entry of Listeria monocytogenes into host cell (R-HSA-8875360 ) InlA-mediated entry of Listeria monocytogenes into host cells (R-HSA-8876493 ) RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 ) Regulation of RUNX2 expression and activity (R-HSA-8939902 ) Regulation of RUNX3 expression and activity (R-HSA-8941858 ) Regulation of PTEN localization (R-HSA-8948747 ) Regulation of PTEN stability and activity (R-HSA-8948751 ) Neddylation (R-HSA-8951664 ) ER Quality Control Compartment (ERQC) (R-HSA-901032 ) Regulation of expression of SLITs and ROBOs (R-HSA-9010553 ) NOTCH3 Activation and Transmission of Signal to the Nucleus (R-HSA-9013507 ) TICAM1-dependent activation of IRF3/IRF7 (R-HSA-9013973 ) TICAM1,TRAF6-dependent induction of TAK1 complex (R-HSA-9014325 ) Interleukin-1 signaling (R-HSA-9020702 ) Peroxisomal protein import (R-HSA-9033241 ) Interferon alpha/beta signaling (R-HSA-909733 ) Regulation of signaling by CBL (R-HSA-912631 ) Endosomal Sorting Complex Required For Transport (ESCRT) (R-HSA-917729 ) Iron uptake and transport (R-HSA-917937 ) Negative regulators of DDX58/IFIH1 signaling (R-HSA-936440 ) Activation of IRF3, IRF7 mediated by TBK1, IKK (IKBKE) (R-HSA-936964 ) IRAK1 recruits IKK complex (R-HSA-937039 ) IKK complex recruitment mediated by RIP1 (R-HSA-937041 ) IRAK2 mediated activation of TAK1 complex (R-HSA-937042 ) TRAF6-mediated induction of TAK1 complex within TLR4 complex (R-HSA-937072 ) Negative regulation of NOTCH4 signaling (R-HSA-9604323 ) Chaperone Mediated Autophagy (R-HSA-9613829 ) Late endosomal microautophagy (R-HSA-9615710 ) Response of EIF2AK4 (GCN2) to amino acid deficiency (R-HSA-9633012 ) Prevention of phagosomal-lysosomal fusion (R-HSA-9636383 ) Modulation by Mtb of host immune system (R-HSA-9637628 ) Alpha-protein kinase 1 signaling pathway (R-HSA-9645460 ) Aggrephagy (R-HSA-9646399 ) RAS processing (R-HSA-9648002 ) Pexophagy (R-HSA-9664873 ) Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350 ) Maturation of protein E (R-HSA-9683683 ) SARS-CoV-1 activates/modulates innate immune responses (R-HSA-9692916 ) Maturation of protein E (R-HSA-9694493 ) Inactivation of CSF3 (G-CSF) signaling (R-HSA-9705462 ) SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 ) Negative regulation of FLT3 (R-HSA-9706369 ) FLT3 signaling by CBL mutants (R-HSA-9706377 ) Regulation of BACH1 activity (R-HSA-9708530 ) SARS-CoV-1 modulates host translation machinery (R-HSA-9735869 ) TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling (R-HSA-975110 ) IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation (R-HSA-975144 ) IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation (R-HSA-975163 ) SARS-CoV-2 modulates host translation machinery (R-HSA-9754678 ) KEAP1-NFE2L2 pathway (R-HSA-9755511 ) Regulation of NF-kappa B signaling (R-HSA-9758274 ) Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) (R-HSA-975956 ) Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC) (R-HSA-975957 ) GSK3B and BTRC (R-HSA-9762114 ) Amyloid fiber formation (R-HSA-977225 ) Antigen processing (R-HSA-983168 ) Translesion synthesis by REV1 (R-HSA-110312 )
BioCyc Pathway	MetaCyc:ENSG00000180019-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Acute leukaemia	DISDQFDI	Strong	Altered Expression	[1]
Al amyloidosis	DISMHVSL	Strong	Altered Expression	[1]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Carcinoma	DISH9F1N	Strong	Altered Expression	[4]
Cognitive impairment	DISH2ERD	Strong	Biomarker	[5]
Colon cancer	DISVC52G	Strong	Altered Expression	[4]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[4]
Cystic fibrosis	DIS2OK1Q	Strong	Biomarker	[6]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[7]
Diamond-Blackfan anemia	DISI2SNW	Strong	Biomarker	[8]
Epidermolysis bullosa	DISVOTZQ	Strong	Genetic Variation	[9]
Epilepsy	DISBB28L	Strong	Biomarker	[10]
Glomerulonephritis	DISPZIQ3	Strong	Biomarker	[11]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[12]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[12]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[15]
Multiple symmetric lipomatosis	DIS22LMD	Strong	Altered Expression	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Neuroblastic tumor	DISKWPS1	Strong	Altered Expression	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[19]
Pancreas disorder	DISDH7NI	Strong	Biomarker	[6]
Parkinson disease	DISQVHKL	Strong	Biomarker	[20]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[23]
Retinoblastoma	DISVPNPB	Strong	Genetic Variation	[24]
Retinopathy	DISB4B0F	Strong	Biomarker	[25]
Seminoma	DIS3J8LJ	Strong	Altered Expression	[26]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[27]
Lymphoma	DISN6V4S	moderate	Altered Expression	[28]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[29]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[30]
Lewy body dementia	DISAE66J	Limited	Altered Expression	[31]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[32]
Pancreatic cancer	DISJC981	Limited	Biomarker	[33]
Sandhoff disease	DISELKA4	Limited	Altered Expression	[34]
------------------------------------------------------------------------------------


⏷ Show the Full List of 41 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[35]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[36]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[37]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[38]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[39]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[40]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[41]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[42]
Benzatropine	DMF7EXL	Approved	Benzatropine increases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[43]
Enzalutamide	DMGL19D	Approved	Enzalutamide affects the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[44]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[47]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[48]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[49]
------------------------------------------------------------------------------------


⏷ Show the Full List of 14 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A).	[46]
------------------------------------------------------------------------------------

References

1	RPS27a promotes proliferation, regulates cell cycle progression and inhibits apoptosis of leukemia cells.Biochem Biophys Res Commun. 2014 Apr 18;446(4):1204-10. doi: 10.1016/j.bbrc.2014.03.086. Epub 2014 Mar 26.
2	Inhibition of UCHL1 by LDN-57444 attenuates Ang II-Induced atrial fibrillation in mice.Hypertens Res. 2020 Mar;43(3):168-177. doi: 10.1038/s41440-019-0354-z. Epub 2019 Nov 7.
3	Quantitative in situ measurement of estrogen receptor mRNA predicts response to tamoxifen.PLoS One. 2012;7(5):e36559. doi: 10.1371/journal.pone.0036559. Epub 2012 May 11.
4	Ubiquitin fusion proteins are overexpressed in colon cancer but not in gastric cancer.Biochim Biophys Acta. 1995 Dec 12;1272(3):147-53. doi: 10.1016/0925-4439(95)00079-8.
5	Correlation of ubiquitin C terminal hydrolase and S100 with cognitive deficits in young adults with mild traumatic brain injury.Neurol India. 2017 Jul-Aug;65(4):761-766. doi: 10.4103/neuroindia.NI_884_15.
6	In silico search for modifier genes associated with pancreatic and liver disease in Cystic Fibrosis.PLoS One. 2017 Mar 24;12(3):e0173822. doi: 10.1371/journal.pone.0173822. eCollection 2017.
7	Investigation of mechanisms of mesenchymal stem cells for treatment of diabetic nephropathy via construction of a miRNA-TF-mRNA network.Ren Fail. 2018 Nov;40(1):136-145. doi: 10.1080/0886022X.2017.1421556. Epub 2018 Mar 13.
8	Overexpression of RPS27a contributes to enhanced chemoresistance of CML cells to imatinib by the transactivated STAT3.Oncotarget. 2016 Apr 5;7(14):18638-50. doi: 10.18632/oncotarget.7888.
9	Epidermolysis bullosa - a group of skin diseases with different causes but commonalities in gene expression.Exp Dermatol. 2012 Jul;21(7):526-30. doi: 10.1111/j.1600-0625.2012.01519.x.
10	The diagnostic value of serum UCHL-1 and S100-B levels in differentiate epileptic seizures from psychogenic attacks.Brain Res. 2019 Feb 1;1704:11-15. doi: 10.1016/j.brainres.2018.09.028. Epub 2018 Sep 22.
11	NF-B upregulates ubiquitin C-terminal hydrolase 1 in diseased podocytes in glomerulonephritis.Mol Med Rep. 2015 Aug;12(2):2893-901. doi: 10.3892/mmr.2015.3780. Epub 2015 May 13.
12	Identification of stable housekeeping genes in response to ionizing radiation in cancer research.Sci Rep. 2017 Mar 6;7:43763. doi: 10.1038/srep43763.
13	Activation of hepatic stellate cells by the ubiquitin C-terminal hydrolase 1 protein secreted from hepatitis C virus-infected hepatocytes.Sci Rep. 2017 Jun 30;7(1):4448. doi: 10.1038/s41598-017-04259-7.
14	Identification of hepatocellular carcinoma-related genes with a machine learning and network analysis.J Comput Biol. 2015 Jan;22(1):63-71. doi: 10.1089/cmb.2014.0122.
15	Inverse correlation of ribosomal protein S27A and multifunctional protein YB-1 in hepatocellular carcinoma.Clin Biochem. 2014 Sep;47(13-14):1262-4. doi: 10.1016/j.clinbiochem.2014.05.004. Epub 2014 May 14.
16	Profiling of differentially expressed genes in adipose tissues of multiple symmetric lipomatosis.Mol Med Rep. 2017 Nov;16(5):6570-6579. doi: 10.3892/mmr.2017.7437. Epub 2017 Sep 7.
17	Structural Basis for the Activation of the Deubiquitinase Calypso by the Polycomb Protein ASX.Structure. 2019 Mar 5;27(3):528-536.e4. doi: 10.1016/j.str.2018.11.013. Epub 2019 Jan 10.
18	The deubiquitinating enzyme UCHL1 is a favorable prognostic marker in neuroblastoma as it promotes neuronal differentiation.J Exp Clin Cancer Res. 2018 Oct 25;37(1):258. doi: 10.1186/s13046-018-0931-z.
19	Downregulation of ubiquitin inhibits the proliferation and radioresistance of non-small cell lung cancer cells in vitro and in vivo.Sci Rep. 2015 Mar 30;5:9476. doi: 10.1038/srep09476.
20	Drosophila Ubiquitin C-Terminal Hydrolase Knockdown Model of Parkinson's Disease.Sci Rep. 2018 Mar 13;8(1):4468. doi: 10.1038/s41598-018-22804-w.
21	Identification and expression of MMSA-8, and its clinical significance in multiple myeloma.Oncol Rep. 2017 Jun;37(6):3235-3243. doi: 10.3892/or.2017.5609. Epub 2017 Apr 28.
22	Targeting the signalling pathways regulated by deubiquitinases for prostate cancer therapeutics.Cell Biochem Funct. 2019 Jul;37(5):304-319. doi: 10.1002/cbf.3401. Epub 2019 May 6.
23	A novel component of the ubiquitin pathway, ubiquitin carboxyl extension protein 1 is overexpressed in prostate cancer.Int J Mol Med. 2005 Feb;15(2):183-96.
24	Tumor suppressor genes associated with drug resistance in ovarian cancer (review).Oncol Rep. 2013 Jul;30(1):3-10. doi: 10.3892/or.2013.2446. Epub 2013 May 9.
25	A ubiquitin C-terminal hydrolase gene on the proximal short arm of the X chromosome: implications for X-linked retinal disorders.Hum Mol Genet. 1996 Apr;5(4):533-8. doi: 10.1093/hmg/5.4.533.
26	Standardization strategy for quantitative PCR in human seminoma and normal testis.J Biotechnol. 2005 May 4;117(2):163-71. doi: 10.1016/j.jbiotec.2005.01.011.
27	Interactions of antisera to different Chlamydia and Chlamydophila species with the ribosomal protein RPS27a correlate with impaired protein synthesis in a human choroid plexus papilloma cell line.Immunol Res. 2017 Dec;65(6):1110-1123. doi: 10.1007/s12026-017-8952-9.
28	Cyclin D1 expression in B-cell lymphomas.Exp Hematol. 2010 Nov;38(11):1047-57. doi: 10.1016/j.exphem.2010.08.002. Epub 2010 Aug 18.
29	The essential and downstream common proteins of amyotrophic lateral sclerosis: A protein-protein interaction network analysis.PLoS One. 2017 Mar 10;12(3):e0172246. doi: 10.1371/journal.pone.0172246. eCollection 2017.
30	Ubiquitin-ribosomal protein S27a gene overexpressed in human colorectal carcinoma is an early growth response gene.Cancer Res. 1993 Apr 15;53(8):1916-20.
31	Reduced ubiquitin C-terminal hydrolase-1 expression levels in dementia with Lewy bodies.Neurobiol Dis. 2006 May;22(2):265-73. doi: 10.1016/j.nbd.2005.11.005. Epub 2005 Dec 27.
32	The uS8, uS4, eS31, and uL14 Ribosomal Protein Genes Are Dysregulated in Nasopharyngeal Carcinoma Cell Lines.Biomed Res Int. 2017;2017:4876954. doi: 10.1155/2017/4876954. Epub 2017 Jul 16.
33	Analysis of the autophagy gene expression profile of pancreatic cancer based on autophagy-related protein microtubule-associated protein 1A/1B-light chain 3.World J Gastroenterol. 2019 May 7;25(17):2086-2098. doi: 10.3748/wjg.v25.i17.2086.
34	Altered gene expression in cells from patients with lysosomal storage disorders suggests impairment of the ubiquitin pathway.Cell Death Differ. 2007 Mar;14(3):511-23. doi: 10.1038/sj.cdd.4402013. Epub 2006 Aug 4.
35	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
36	Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
37	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
38	Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
39	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
40	Transcriptomic Analysis of Stem Cells Treated with Moringin or Cannabidiol: Analogies and Differences in Inflammation Pathways. Int J Mol Sci. 2019 Nov 30;20(23):6039. doi: 10.3390/ijms20236039.
41	Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
42	Nicotine Promotes Human Papillomavirus (HPV)-Immortalized Cervical Epithelial Cells (H8) Proliferation by Activating RPS27a-Mdm2-P53 Pathway In Vitro. Toxicol Sci. 2019 Feb 1;167(2):408-418. doi: 10.1093/toxsci/kfy246.
43	Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
44	NOTCH signaling is activated in and contributes to resistance in enzalutamide-resistant prostate cancer cells. J Biol Chem. 2019 May 24;294(21):8543-8554. doi: 10.1074/jbc.RA118.006983. Epub 2019 Apr 2.
45	Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
46	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
47	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
48	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
49	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.