Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJFS67N)

• DOT Name: COUP transcription factor 2 (NR2F2)
• Synonyms: COUP-TF2; Apolipoprotein A-I regulatory protein 1; ARP-1; COUP transcription factor II; COUP-TF II; Nuclear receptor subfamily 2 group F member 2
• Gene Name: NR2F2
• Related Disease:
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  NR2F2 related multiple congenital anomalies/dysmorphic syndrome
  Acute leukaemia
  Adult glioblastoma
  Advanced cancer
  Astrocytoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Choriocarcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Congenital diaphragmatic hernia
  Congenital heart defects, multiple types, 4
  Glioblastoma multiforme
  Glioma
  Grade II glioma
  Hepatocellular carcinoma
  Immunodeficiency
  Lung cancer
  Lung carcinoma
  Maturity-onset diabetes of the young
  Neoplasm
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Spinocerebellar ataxia type 5
  Uterine fibroids
  Ventricular septal defect
  Clear cell renal carcinoma
  Endometriosis
  Female infertility
  Renal cell carcinoma
  High blood pressure
  Epithelial ovarian cancer
  Maturity-onset diabetes of the young type 1
  Oculocutaneous albinism
  Ovarian cancer
  Ovarian neoplasm
  X-linked adrenal hypoplasia congenita
• UniProt ID: COT2_HUMAN
• PDB ID: 3CJW
• Pfam ID: PF00104 ; PF00105
• Sequence:
  MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
  GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
  CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
  YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
  QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
  KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
  GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
• Function: Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. May be required to establish ovary identity during early gonad development.
• Tissue Specificity: Ubiquitous. Expressed in the stromal cells of developing fetal ovaries .
• Reactome Pathway: Transcriptional regulation of white adipocyte differentiation (R-HSA-381340)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Definitive	Biomarker	[1]
Liver cancer	DISDE4BI	Definitive	Biomarker	[1]
NR2F2 related multiple congenital anomalies/dysmorphic syndrome	DISIEALR	Definitive	Autosomal dominant	[2]
Acute leukaemia	DISDQFDI	Strong	Genetic Variation	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[5]
Astrocytoma	DISL3V18	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[8]
Choriocarcinoma	DISDBVNL	Strong	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[10]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[11]
Congenital diaphragmatic hernia	DIS0IPVU	Strong	Genetic Variation	[12]
Congenital heart defects, multiple types, 4	DISW5R4Q	Strong	Autosomal dominant	[13]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[6]
Glioma	DIS5RPEH	Strong	Biomarker	[6]
Grade II glioma	DIS9NNT0	Strong	Altered Expression	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Immunodeficiency	DIS093I0	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[5]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[5]
Maturity-onset diabetes of the young	DISG75M5	Strong	Genetic Variation	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[6]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[17]
Prostate cancer	DISF190Y	Strong	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[18]
Spinocerebellar ataxia type 5	DISPYXJ0	Strong	Genetic Variation	[19]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[20]
Ventricular septal defect	DISICO41	Strong	Genetic Variation	[21]
Clear cell renal carcinoma	DISBXRFJ	moderate	Altered Expression	[22]
Endometriosis	DISX1AG8	moderate	Altered Expression	[23]
Female infertility	DIS9GNYZ	moderate	Biomarker	[24]
Renal cell carcinoma	DISQZ2X8	moderate	Altered Expression	[22]
High blood pressure	DISY2OHH	Disputed	Biomarker	[25]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[26]
Maturity-onset diabetes of the young type 1	DISADKR0	Limited	Genetic Variation	[27]
Oculocutaneous albinism	DISJS7CU	Limited	Genetic Variation	[28]
Ovarian cancer	DISZJHAP	Limited	Altered Expression	[26]
Ovarian neoplasm	DISEAFTY	Limited	Altered Expression	[26]
X-linked adrenal hypoplasia congenita	DISNMXY8	Limited	Biomarker	[29]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of COUP transcription factor 2 (NR2F2).	[30]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of COUP transcription factor 2 (NR2F2).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of COUP transcription factor 2 (NR2F2).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of COUP transcription factor 2 (NR2F2).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of COUP transcription factor 2 (NR2F2).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of COUP transcription factor 2 (NR2F2).	[35]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of COUP transcription factor 2 (NR2F2).	[36]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of COUP transcription factor 2 (NR2F2).	[37]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of COUP transcription factor 2 (NR2F2).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of COUP transcription factor 2 (NR2F2).	[39]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of COUP transcription factor 2 (NR2F2).	[40]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of COUP transcription factor 2 (NR2F2).	[41]
Marinol	DM70IK5	Approved	Marinol increases the expression of COUP transcription factor 2 (NR2F2).	[42]
Menadione	DMSJDTY	Approved	Menadione affects the expression of COUP transcription factor 2 (NR2F2).	[40]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of COUP transcription factor 2 (NR2F2).	[43]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of COUP transcription factor 2 (NR2F2).	[44]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of COUP transcription factor 2 (NR2F2).	[41]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the expression of COUP transcription factor 2 (NR2F2).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of COUP transcription factor 2 (NR2F2).	[43]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of COUP transcription factor 2 (NR2F2).	[32]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of COUP transcription factor 2 (NR2F2).	[46]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of COUP transcription factor 2 (NR2F2).	[47]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of COUP transcription factor 2 (NR2F2).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of COUP transcription factor 2 (NR2F2).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of COUP transcription factor 2 (NR2F2).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of COUP transcription factor 2 (NR2F2).	[50]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of COUP transcription factor 2 (NR2F2).	[36]

References

• [1] COUP-TFII is a modulator of cell-type-specific genetic programs based on genomic localization maps.J Biotechnol. 2019 Aug 10;301:11-17. doi: 10.1016/j.jbiotec.2019.05.305. Epub 2019 May 31.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Identification and characterization of the ARP1 gene, a target for the human acute leukemia ALL1 gene.Proc Natl Acad Sci U S A. 1998 Apr 14;95(8):4573-8. doi: 10.1073/pnas.95.8.4573.
• [4] Downregulation of COUP-TFII inhibits glioblastoma growth via targeting MPC1.Oncol Lett. 2018 Jun;15(6):9697-9702. doi: 10.3892/ol.2018.8601. Epub 2018 Apr 27.
• [5] Overexpression of COUPTFII suppresses proliferation and metastasis of human gastric cancer cells.Mol Med Rep. 2018 Feb;17(2):2393-2401. doi: 10.3892/mmr.2017.8164. Epub 2017 Nov 27.
• [6] Prognostic Role of Chicken Ovalbumin Upstream Promoter Transcription Factor II in Isocitrate Dehydrogenase-Mutant Glioma with 1p19q Co-Deletion.J Mol Neurosci. 2019 Jun;68(2):234-242. doi: 10.1007/s12031-019-01281-4. Epub 2019 Mar 30.
• [7] High NR2F2 transcript level is associated with increased survival and its expression inhibits TGF--dependent epithelial-mesenchymal transition in breast cancer.Breast Cancer Res Treat. 2014 Sep;147(2):265-81. doi: 10.1007/s10549-014-3095-3. Epub 2014 Aug 17.
• [8] 5-Aza-2-deoxycytidine and trichostatin A increase COUP-TFII expression in antiestrogen-resistant breast cancer cell lines.Cancer Lett. 2014 May 28;347(1):139-50. doi: 10.1016/j.canlet.2014.02.001. Epub 2014 Feb 7.
• [9] The ARP-1 orphan receptor represses steroid-mediated stimulation of human placental lactogen gene expression.J Mol Endocrinol. 1996 Jun;16(3):221-7. doi: 10.1677/jme.0.0160221.
• [10] Expression of chicken ovalbumin upstream promoter-transcription factor II and liver X receptor as prognostic indicators for human colorectal cancer.Oncol Lett. 2017 Oct;14(4):4011-4020. doi: 10.3892/ol.2017.6659. Epub 2017 Jul 24.
• [11] Clinical significance of chicken ovalbumin upstream promoter-transcription factor II expression in human colorectal cancer.Oncol Rep. 2009 Jan;21(1):101-6.
• [12] Germline but not somatic de novo mutations are common in human congenital diaphragmatic hernia.Birth Defects Res. 2018 Apr 17;110(7):610-617. doi: 10.1002/bdr2.1223. Epub 2018 Mar 23.
• [13] The orphan nuclear receptor COUP-TFII is required for angiogenesis and heart development. Genes Dev. 1999 Apr 15;13(8):1037-49. doi: 10.1101/gad.13.8.1037.
• [14] Repression by ARP-1 sensitizes apolipoprotein AI gene responsiveness to RXR alpha and retinoic acid.Mol Cell Biol. 1992 Aug;12(8):3380-9. doi: 10.1128/mcb.12.8.3380-3389.1992.
• [15] Rice-based oral antibody fragment prophylaxis and therapy against rotavirus infection.J Clin Invest. 2013 Sep;123(9):3829-38. doi: 10.1172/JCI70266. Epub 2013 Aug 8.
• [16] Functional study of the E276Q mutant hepatocyte nuclear factor-4alpha found in type 1 maturity-onset diabetes of the young: impaired synergy with chicken ovalbumin upstream promoter transcription factor II on the hepatocyte nuclear factor-1 promoter.Diabetes. 1999 May;48(5):1162-7. doi: 10.2337/diabetes.48.5.1162.
• [17] DCZ0814 induces apoptosis and G0/G1 phase cell cycle arrest in myeloma by dual inhibition of mTORC1/2.Cancer Manag Res. 2019 May 27;11:4797-4808. doi: 10.2147/CMAR.S194202. eCollection 2019.
• [18] MPC1, a key gene in cancer metabolism, is regulated by COUPTFII in human prostate cancer.Oncotarget. 2016 Mar 22;7(12):14673-83. doi: 10.18632/oncotarget.7405.
• [19] Beta-III spectrin mutation L253P associated with spinocerebellar ataxia type 5 interferes with binding to Arp1 and protein trafficking from the Golgi.Hum Mol Genet. 2010 Sep 15;19(18):3634-41. doi: 10.1093/hmg/ddq279. Epub 2010 Jul 5.
• [20] Aberrant expression and regulation of NR2F2 and CTNNB1 in uterine fibroids.Reproduction. 2013 Jun 27;146(2):91-102. doi: 10.1530/REP-13-0087. Print 2013 Aug.
• [21] A novel NR2F2 loss-of-function mutation predisposes to congenital heart defect.Eur J Med Genet. 2018 Apr;61(4):197-203. doi: 10.1016/j.ejmg.2017.12.003. Epub 2017 Dec 6.
• [22] Orphan nuclear receptor COUP-TFII is an oncogenic gene in renal cell carcinoma.Clin Transl Oncol. 2020 May;22(5):772-781. doi: 10.1007/s12094-019-02190-z. Epub 2019 Jul 31.
• [23] Suppression of COUP-TFII upregulates angiogenin and promotes angiogenesis in endometriosis.Hum Reprod. 2018 Aug 1;33(8):1517-1527. doi: 10.1093/humrep/dey220.
• [24] COUP-TFII mediates progesterone regulation of uterine implantation by controlling ER activity.PLoS Genet. 2007 Jun;3(6):e102. doi: 10.1371/journal.pgen.0030102.
• [25] Mutation within the hinge region of the transcription factor Nr2f2 attenuates salt-sensitive hypertension.Nat Commun. 2015 Feb 17;6:6252. doi: 10.1038/ncomms7252.
• [26] Expression and functional pathway analysis of nuclear receptor NR2F2 in ovarian cancer.J Clin Endocrinol Metab. 2013 Jul;98(7):E1152-62. doi: 10.1210/jc.2013-1081. Epub 2013 May 20.
• [27] Maturity-onset diabetes of the young Type 1 (MODY1)-associated mutations R154X and E276Q in hepatocyte nuclear factor 4alpha (HNF4alpha) gene impair recruitment of p300, a key transcriptional co-activator.Mol Endocrinol. 2001 Jul;15(7):1200-10. doi: 10.1210/mend.15.7.0670.
• [28] Proportional growth failure and oculocutaneous albinism in a girl with a 6.87 Mb deletion of region 15q26.2-->qter.Eur J Med Genet. 2007 Nov-Dec;50(6):432-40. doi: 10.1016/j.ejmg.2007.08.003. Epub 2007 Sep 9.
• [29] Minireview: role of orphan nuclear receptors in cancer and potential as drug targets.Mol Endocrinol. 2014 Feb;28(2):157-72. doi: 10.1210/me.2013-1291. Epub 2013 Dec 2.
• [30] Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
• [31] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [32] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [33] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [36] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [37] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [38] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [39] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [40] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [41] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [42] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [45] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [46] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [47] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Expression of selected nuclear receptors in human epithelial ovarian cell line Caov3 exposed to bisphenol derivatives. Endocr Regul. 2023 Sep 16;57(1):191-199. doi: 10.2478/enr-2023-0023. Print 2023 Jan 1.
• [50] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.