Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK71JYU)

• DOT Name: Activated RNA polymerase II transcriptional coactivator p15 (SUB1)
• Synonyms: Positive cofactor 4; PC4; SUB1 homolog; p14
• Gene Name: SUB1
• Related Disease:
  Adenocarcinoma
  Carcinoma
  Chromosomal disorder
  Lung adenocarcinoma
  Transitional cell carcinoma
  Urinary bladder cancer
  Acute monocytic leukemia
  Adult lymphoma
  Adult T-cell leukemia/lymphoma
  Advanced cancer
  Astrocytoma
  Bladder cancer
  Breast cancer
  Carcinoma of esophagus
  Clear cell renal carcinoma
  Colorectal carcinoma
  Esophageal squamous cell carcinoma
  Glioma
  Head-neck squamous cell carcinoma
  Hepatitis B virus infection
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Leukemia
  Lung cancer
  Lymphoma
  Myelodysplastic syndrome
  Neoplasm of esophagus
  Ovarian neoplasm
  Pancreatic cancer
  Pediatric lymphoma
  Plasma cell myeloma
  Renal cell carcinoma
  Small lymphocytic lymphoma
  Squamous cell carcinoma
  T-cell lymphoma
  Urinary bladder neoplasm
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Gastric cancer
  Promyelocytic leukaemia
  Childhood acute lymphoblastic leukemia
  Acute leukaemia
  Breast carcinoma
  leukaemia
  Non-hodgkin lymphoma
  Non-small-cell lung cancer
  Retinoblastoma
  Stomach cancer
• UniProt ID: TCP4_HUMAN
• PDB ID: 1PCF; 2C62; 2PHE; 4USG; 6YCS; 7E4W
• Pfam ID: PF02229
• Sequence:
  MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRD
  DNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDI
  DDAVRKL
• Function: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Posttranslational Modification	[1]
Carcinoma	DISH9F1N	Definitive	Biomarker	[2]
Chromosomal disorder	DISM5BB5	Definitive	Genetic Variation	[3]
Lung adenocarcinoma	DISD51WR	Definitive	Altered Expression	[4]
Transitional cell carcinoma	DISWVVDR	Definitive	Altered Expression	[5]
Urinary bladder cancer	DISDV4T7	Definitive	Posttranslational Modification	[6]
Acute monocytic leukemia	DIS28NEL	Strong	Posttranslational Modification	[7]
Adult lymphoma	DISK8IZR	Strong	Altered Expression	[8]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[9]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[10]
Astrocytoma	DISL3V18	Strong	Genetic Variation	[11]
Bladder cancer	DISUHNM0	Strong	Posttranslational Modification	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[12]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[13]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[14]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[15]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[16]
Glioma	DIS5RPEH	Strong	Biomarker	[17]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Posttranslational Modification	[18]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[19]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[20]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[21]
Leukemia	DISNAKFL	Strong	Genetic Variation	[22]
Lung cancer	DISCM4YA	Strong	Posttranslational Modification	[23]
Lymphoma	DISN6V4S	Strong	Altered Expression	[8]
Myelodysplastic syndrome	DISYHNUI	Strong	Posttranslational Modification	[24]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[13]
Ovarian neoplasm	DISEAFTY	Strong	Posttranslational Modification	[25]
Pancreatic cancer	DISJC981	Strong	Biomarker	[26]
Pediatric lymphoma	DIS51BK2	Strong	Altered Expression	[8]
Plasma cell myeloma	DIS0DFZ0	Strong	Posttranslational Modification	[27]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[14]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[28]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[29]
T-cell lymphoma	DISSXRTQ	Strong	Altered Expression	[30]
Urinary bladder neoplasm	DIS7HACE	Strong	Posttranslational Modification	[6]
Acute lymphocytic leukaemia	DISPX75S	moderate	Posttranslational Modification	[24]
Acute myelogenous leukaemia	DISCSPTN	moderate	Posttranslational Modification	[24]
Gastric cancer	DISXGOUK	moderate	Biomarker	[31]
Promyelocytic leukaemia	DISYGG13	moderate	Posttranslational Modification	[32]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Disputed	Posttranslational Modification	[24]
Acute leukaemia	DISDQFDI	Limited	Biomarker	[24]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[12]
leukaemia	DISS7D1V	Limited	Genetic Variation	[22]
Non-hodgkin lymphoma	DISS2Y8A	Limited	Biomarker	[33]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[16]
Retinoblastoma	DISVPNPB	Limited	Altered Expression	[34]
Stomach cancer	DISKIJSX	Limited	Biomarker	[31]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[38]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[39]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[40]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[41]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[42]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[43]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[44]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[45]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[49]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[43]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[50]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[51]
AHPN	DM8G6O4	Investigative	AHPN increases the expression of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[52]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[48]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Activated RNA polymerase II transcriptional coactivator p15 (SUB1).	[48]

References

• [1] EBV-infection in cardiac and non-cardiac gastric adenocarcinomas is associated with promoter methylation of p16, p14 and APC, but not hMLH1.Cell Oncol (Dordr). 2011 Jun;34(3):209-14. doi: 10.1007/s13402-011-0028-6. Epub 2011 May 3.
• [2] p14 expression differences in ovarian benign, borderline and malignant epithelial tumors.J Ovarian Res. 2016 Oct 22;9(1):69. doi: 10.1186/s13048-016-0275-2.
• [3] Concomitant aberrant methylation of p15 and MGMT genes in acute myeloid leukemia: association with a particular immunophenotype of blast cells.Med Oncol. 2012 Dec;29(5):3547-56. doi: 10.1007/s12032-012-0289-6. Epub 2012 Jul 7.
• [4] Adenovirus-Mediated Expression of the p14 Fusion-Associated Small Transmembrane Protein Promotes Cancer Cell Fusion and Apoptosis In Vitro but Does Not Provide Therapeutic Efficacy in a Xenograft Mouse Model of Cancer.PLoS One. 2016 Mar 17;11(3):e0151516. doi: 10.1371/journal.pone.0151516. eCollection 2016.
• [5] Deletions of p15 and p16 in schistosomal bladder cancer correlate with transforming growth factor-alpha expression.Clin Biochem. 2004 Dec;37(12):1098-104. doi: 10.1016/j.clinbiochem.2004.09.006.
• [6] Hypermethylation of E-cadherin, p16, p14, and RASSF1A genes in pathologically normal urothelium predict bladder recurrence of bladder cancer after transurethral resection.Urol Oncol. 2012 Mar-Apr;30(2):177-81. doi: 10.1016/j.urolonc.2010.01.002. Epub 2010 Aug 25.
• [7] KG-1 and KG-1a model the p15 CpG island methylation observed in acute myeloid leukemia patients.Leuk Res. 2001 Oct;25(10):917-25. doi: 10.1016/s0145-2126(01)00053-4.
• [8] Primary malignant lymphoma of the brain: frequent abnormalities and inactivation of p14 tumor suppressor gene.Cancer Sci. 2005 Jan;96(1):38-41. doi: 10.1111/j.1349-7006.2005.00003.x.
• [9] Role of tumor suppressor genes in the development of adult T cell leukemia/lymphoma (ATLL).Leukemia. 2002 Jun;16(6):1069-85. doi: 10.1038/sj.leu.2402458.
• [10] An Oncolytic Adenovirus Vector Expressing p14 FAST Protein Induces Widespread Syncytium Formation and Reduces Tumor Growth Rate InVivo.Mol Ther Oncolytics. 2019 May 15;14:107-120. doi: 10.1016/j.omto.2019.05.001. eCollection 2019 Sep 27.
• [11] Comparative genomic hybridization in glioma: a meta-analysis of 509 cases.Cancer Genet Cytogenet. 2002 Jun;135(2):147-59. doi: 10.1016/s0165-4608(01)00650-1.
• [12] Transcriptional positive cofactor 4 promotes breast cancer proliferation and metastasis through c-Myc mediated Warburg effect.Cell Commun Signal. 2019 Apr 16;17(1):36. doi: 10.1186/s12964-019-0348-0.
• [13] LncRNA SNHG7 promotes the proliferation of esophageal cancer cells and inhibits its apoptosis.Eur Rev Med Pharmacol Sci. 2018 May;22(9):2653-2661. doi: 10.26355/eurrev_201805_14961.
• [14] Major role for a 3p21 region and lack of involvement of the t(3;8) breakpoint region in the development of renal cell carcinoma suggested by loss of heterozygosity analysis.Genes Chromosomes Cancer. 1996 Jan;15(1):64-72. doi: 10.1002/(SICI)1098-2264(199601)15:1<64::AID-GCC9>3.0.CO;2-2.
• [15] Long noncoding RNA BLACAT1 indicates a poor prognosis of colorectal cancer and affects cell proliferation by epigenetically silencing of p15.Cell Death Dis. 2017 Mar 9;8(3):e2665. doi: 10.1038/cddis.2017.83.
• [16] Inhibition of PC4 radiosensitizes non-small cell lung cancer by transcriptionally suppressing XLF.Cancer Med. 2018 Apr;7(4):1326-1337. doi: 10.1002/cam4.1332. Epub 2018 Mar 9.
• [17] Frequent and variable abnormalities in p14 tumor suppressor gene in glioma cell lines.Brain Tumor Pathol. 2008;25(1):9-17. doi: 10.1007/s10014-007-0226-0. Epub 2008 Apr 16.
• [18] Smoking and drinking can induce p15 methylation in the upper aerodigestive tract of healthy individuals and patients with head and neck squamous cell carcinoma.Cancer. 2004 Jul 1;101(1):125-32. doi: 10.1002/cncr.20323.
• [19] Promoter hypermethylation of p14 (ARF) , RB, and INK4 gene family in hepatocellular carcinoma with hepatitis B virus infection.Tumour Biol. 2014 Mar;35(3):2795-802. doi: 10.1007/s13277-013-1372-0. Epub 2013 Nov 20.
• [20] Hepatitis C virus Core overcomes all-trans retinoic acid-induced apoptosis in human hepatoma cells by inhibiting p14 expression via DNA methylation.Oncotarget. 2017 Aug 18;8(49):85584-85598. doi: 10.18632/oncotarget.20337. eCollection 2017 Oct 17.
• [21] Depletion of histone demethylase KDM5B inhibits cell proliferation of hepatocellular carcinoma by regulation of cell cycle checkpoint proteins p15 and p27.J Exp Clin Cancer Res. 2016 Feb 25;35:37. doi: 10.1186/s13046-016-0311-5.
• [22] Regulation of DNA methylation and tumor suppression gene expression by miR-29b in leukemia patients and related mechanisms.Eur Rev Med Pharmacol Sci. 2018 Jan;22(1):158-165. doi: 10.26355/eurrev_201801_14113.
• [23] Aberrant p16 promoter methylation in smokers and former smokers with nonsmall cell lung cancer.Int J Cancer. 2003 Oct 10;106(6):913-8. doi: 10.1002/ijc.11322.
• [24] Prognostic impact of p15 gene aberrations in acute leukemia.Leuk Lymphoma. 2017 Feb;58(2):257-265. doi: 10.1080/10428194.2016.1201574. Epub 2016 Jul 12.
• [25] Hypermethylation of P15, P16, and E-cadherin genes in ovarian cancer.Toxicol Ind Health. 2015 Oct;31(10):924-30. doi: 10.1177/0748233713484657. Epub 2013 Apr 9.
• [26] Blind SELEX Approach Identifies RNA Aptamers That Regulate EMT and Inhibit Metastasis.Mol Cancer Res. 2017 Jul;15(7):811-820. doi: 10.1158/1541-7786.MCR-16-0462. Epub 2017 Apr 10.
• [27] Aberrant promoter methylation of p15 (INKb) and p16 (INKa) genes may contribute to the pathogenesis of multiple myeloma: a meta-analysis.Tumour Biol. 2014 Sep;35(9):9035-43. doi: 10.1007/s13277-014-2054-2. Epub 2014 Jun 8.
• [28] CpG island methylation patterns in chronic lymphocytic leukemia.Leuk Lymphoma. 2009 Mar;50(3):419-26. doi: 10.1080/10428190902756594.
• [29] Frequency of genetic and epigenetic alterations of p14ARF and p16INK4A in head and neck cancer in a Hungarian population.Pathol Oncol Res. 2014 Oct;20(4):923-9. doi: 10.1007/s12253-014-9775-9. Epub 2014 Apr 9.
• [30] Frequent methylation silencing of p15(INK4b) (MTS2) and p16(INK4a) (MTS1) in B-cell and T-cell lymphomas.Blood. 1999 Sep 1;94(5):1773-81.
• [31] LncRNA SNHG17 promotes gastric cancer progression by epigenetically silencing of p15 and p57.J Cell Physiol. 2019 Apr;234(4):5163-5174. doi: 10.1002/jcp.27320. Epub 2018 Sep 6.
• [32] p15(Ink4b) Loss of Expression by Promoter Hypermethylation Adds to Leukemogenesis and Confers a Poor Prognosis in Acute Promyelocytic Leukemia Patients.Cancer Res Treat. 2017 Jul;49(3):790-797. doi: 10.4143/crt.2016.108. Epub 2016 Dec 5.
• [33] Frequent abnormalities of the p15 and p16 genes in mycosis fungoides and sezary syndrome.J Invest Dermatol. 2002 Mar;118(3):493-9. doi: 10.1046/j.0022-202x.2001.01682.x.
• [34] Biallelic deletions in INK4 in cutaneous melanoma are common and associated with decreased survival.Clin Cancer Res. 2005 Apr 15;11(8):2991-7. doi: 10.1158/1078-0432.CCR-04-1731.
• [35] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [36] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [40] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [41] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [42] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [43] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [44] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [45] Proteomic analysis of anti-cancer effects by paclitaxel treatment in cervical cancer cells. Gynecol Oncol. 2005 Jul;98(1):45-53. doi: 10.1016/j.ygyno.2005.04.010.
• [46] Genomic and proteomic profiling of responses to toxic metals in human lung cells. Environ Health Perspect. 2003 May;111(6):825-35.
• [47] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [48] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [49] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [50] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [51] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [52] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.