Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOC4UNG)

• DOT Name: Hepatocyte growth factor-like protein (MST1)
• Synonyms: Macrophage stimulatory protein; Macrophage-stimulating protein; MSP
• Gene Name: MST1
• Related Disease:
  Dilated cardiomyopathy 1A
  Renal cell carcinoma
  Acute liver failure
  Adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Amyotrophic lateral sclerosis
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Congestive heart failure
  Crohn disease
  Ductal breast carcinoma in situ
  Gastric cancer
  Hepatocellular carcinoma
  Multiple sclerosis
  Non-small-cell lung cancer
  Primary sclerosing cholangitis
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Sclerosing cholangitis
  Squamous cell carcinoma
  Stomach cancer
  Subarachnoid hemorrhage
  Type-1/2 diabetes
  Asthma
  Combined immunodeficiency due to STK4 deficiency
  Epidermodysplasia verruciformis
  Liver cirrhosis
  Lung cancer
  Lung carcinoma
  Melanoma
  Metastatic malignant neoplasm
  Pancreatic cancer
  Ankylosing spondylitis
  Inflammatory bowel disease
  Myocardial infarction
  Psoriasis
  Small-cell lung cancer
  Ulcerative colitis
• UniProt ID: HGFL_HUMAN
• PDB ID: 2ASU; 4QT8
• Pfam ID: PF00051 ; PF00024 ; PF00089
• Sequence:
  MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
  GPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG
  TMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQS
  CGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYC
  RNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTA
  GVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRR
  CTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCR
  NPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRS
  KLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGT
  LFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT
  KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGD
  YGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG
• KEGG Pathway: Calcium sig.ling pathway (hsa04020)
• Reactome Pathway: Signaling by MST1 (R-HSA-8852405)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Dilated cardiomyopathy 1A	DIS0RK9Z	Definitive	Biomarker	[1]
Renal cell carcinoma	DISQZ2X8	Definitive	Posttranslational Modification	[2]
Acute liver failure	DIS5EZKX	Strong	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Posttranslational Modification	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[7]
Autoimmune disease	DISORMTM	Strong	Altered Expression	[8]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[9]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[10]
Carcinoma	DISH9F1N	Strong	Posttranslational Modification	[11]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Altered Expression	[13]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[13]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[14]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[15]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Genetic Variation	[16]
Gastric cancer	DISXGOUK	Strong	Posttranslational Modification	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[20]
Primary sclerosing cholangitis	DISTH5WJ	Strong	Genetic Variation	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[23]
Sclerosing cholangitis	DIS7GZNB	Strong	Genetic Variation	[24]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[4]
Stomach cancer	DISKIJSX	Strong	Posttranslational Modification	[17]
Subarachnoid hemorrhage	DISI7I8Y	Strong	Biomarker	[25]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[26]
Asthma	DISW9QNS	moderate	Genetic Variation	[27]
Combined immunodeficiency due to STK4 deficiency	DISYACRR	Moderate	Autosomal recessive	[28]
Epidermodysplasia verruciformis	DIS54WBS	Moderate	Unknown	[29]
Liver cirrhosis	DIS4G1GX	moderate	Biomarker	[30]
Lung cancer	DISCM4YA	moderate	Genetic Variation	[31]
Lung carcinoma	DISTR26C	moderate	Genetic Variation	[31]
Melanoma	DIS1RRCY	moderate	Biomarker	[32]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[33]
Pancreatic cancer	DISJC981	moderate	Biomarker	[34]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[35]
Inflammatory bowel disease	DISGN23E	Limited	Genetic Variation	[36]
Myocardial infarction	DIS655KI	Limited	Biomarker	[37]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[35]
Small-cell lung cancer	DISK3LZD	Limited	Altered Expression	[38]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[36]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Hepatocyte growth factor-like protein (MST1).	[39]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine increases the phosphorylation of Hepatocyte growth factor-like protein (MST1).	[46]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Hepatocyte growth factor-like protein (MST1).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Hepatocyte growth factor-like protein (MST1).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Hepatocyte growth factor-like protein (MST1).	[42]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Hepatocyte growth factor-like protein (MST1).	[43]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Hepatocyte growth factor-like protein (MST1).	[44]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Hepatocyte growth factor-like protein (MST1).	[45]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Hepatocyte growth factor-like protein (MST1).	[47]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Hepatocyte growth factor-like protein (MST1).	[44]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Hepatocyte growth factor-like protein (MST1).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Hepatocyte growth factor-like protein (MST1).	[49]

References

• [1] Galectin-3 deficiency ameliorates fibrosis and remodeling in dilated cardiomyopathy mice with enhanced Mst1 signaling.Am J Physiol Heart Circ Physiol. 2019 Jan 1;316(1):H45-H60. doi: 10.1152/ajpheart.00609.2018. Epub 2018 Nov 2.
• [2] The Silencing of CCND2 by Promoter Aberrant Methylation in Renal Cell Cancer and Analysis of the Correlation between CCND2 Methylation Status and Clinical Features.PLoS One. 2016 Sep 1;11(9):e0161859. doi: 10.1371/journal.pone.0161859. eCollection 2016.
• [3] Hepatic expression of hepatocyte-growth-factor-like/macrophage-stimulating protein mRNA in fulminant hepatic failure.Lancet. 1994 Jul 2;344(8914):27-9. doi: 10.1016/s0140-6736(94)91050-2.
• [4] Protein signatures of molecular pathways in non-small cell lung carcinoma (NSCLC): comparison of glycoproteomics and global proteomics.Clin Proteomics. 2017 Aug 15;14:31. doi: 10.1186/s12014-017-9166-9. eCollection 2017.
• [5] Real-Time Methylation-Specific Polymerase Chain Reaction for MGMT Promoter Methylation Clinical Testing in Glioblastoma: An Alternative Detection Method for a Heterogeneous Process.Am J Clin Pathol. 2017 Oct 1;148(4):296-307. doi: 10.1093/ajcp/aqx073.
• [6] Mst1 inhibition attenuates non-alcoholic fatty liver disease via reversing Parkin-related mitophagy.Redox Biol. 2019 Feb;21:101120. doi: 10.1016/j.redox.2019.101120. Epub 2019 Jan 23.
• [7] VAMP associated proteins are required for autophagic and lysosomal degradation by promoting a PtdIns4P-mediated endosomal pathway.Autophagy. 2019 Jul;15(7):1214-1233. doi: 10.1080/15548627.2019.1580103. Epub 2019 Feb 20.
• [8] Hippo Kinases Mst1 and Mst2 Sense and Amplify IL-2R-STAT5 Signaling in Regulatory T Cells to Establish Stable Regulatory Activity.Immunity. 2018 Nov 20;49(5):899-914.e6. doi: 10.1016/j.immuni.2018.10.010. Epub 2018 Nov 6.
• [9] Mst1-Hippo pathway triggers breast cancer apoptosis via inducing mitochondrial fragmentation in a manner dependent on JNK-Drp1 axis.Onco Targets Ther. 2019 Feb 11;12:1147-1159. doi: 10.2147/OTT.S193787. eCollection 2019.
• [10] ESR1 Methylation: A Liquid Biopsy-Based Epigenetic Assay for the Follow-up of Patients with Metastatic Breast Cancer Receiving Endocrine Treatment.Clin Cancer Res. 2018 Mar 15;24(6):1500-1510. doi: 10.1158/1078-0432.CCR-17-1181. Epub 2017 Dec 28.
• [11] Genome-wide methylation profiling identifies hypermethylated biomarkers in high-grade cervical intraepithelial neoplasia.Epigenetics. 2012 Nov;7(11):1268-78. doi: 10.4161/epi.22301. Epub 2012 Sep 27.
• [12] Methylation of the gamma-catenin gene is associated with poor prognosis of renal cell carcinoma.Clin Cancer Res. 2005 Jan 15;11(2 Pt 1):557-64.
• [13] MiR-590-3p promotes proliferation and metastasis of colorectal cancer via Hippo pathway.Oncotarget. 2017 Jul 22;8(35):58061-58071. doi: 10.18632/oncotarget.19487. eCollection 2017 Aug 29.
• [14] Mst1 knockout enhances cardiomyocyte autophagic flux to alleviate angiotensin II-induced cardiac injury independent of angiotensin II receptors.J Mol Cell Cardiol. 2018 Dec;125:117-128. doi: 10.1016/j.yjmcc.2018.08.028. Epub 2018 Sep 5.
• [15] A novel susceptibility locus in MST1 and gene-gene interaction network for Crohn's disease in the Chinese population.J Cell Mol Med. 2018 Apr;22(4):2368-2377. doi: 10.1111/jcmm.13530. Epub 2018 Feb 14.
• [16] Differences in Breast Cancer Characteristics by Mammography Screening Participation or Non-Participation.Dtsch Arztebl Int. 2018 Aug 6;115(31-32):520-527. doi: 10.3238/arztebl.2018.0520.
• [17] DNA diagnosis of peritoneal fluid cytology test by CDO1 promoter DNA hypermethylation in gastric cancer.Gastric Cancer. 2017 Sep;20(5):784-792. doi: 10.1007/s10120-017-0697-6. Epub 2017 Feb 27.
• [18] Berberine induced modulation of PHLPP2-Akt-MST1 kinase signaling is coupled with mitochondrial impairment and hepatoma cell death.Toxicol Appl Pharmacol. 2018 May 15;347:92-103. doi: 10.1016/j.taap.2018.03.033. Epub 2018 Apr 4.
• [19] Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.Ann Neurol. 2011 Dec;70(6):897-912. doi: 10.1002/ana.22609.
• [20] Mst1/2 kinases restrain transformation in a novel transgenic model of Ras driven non-small cell lung cancer.Oncogene. 2020 Jan;39(5):1152-1164. doi: 10.1038/s41388-019-1031-z. Epub 2019 Sep 30.
• [21] Macrophage stimulating protein variation enhances the risk of sporadic extrahepatic cholangiocarcinoma.Dig Liver Dis. 2013 Jul;45(7):612-5. doi: 10.1016/j.dld.2012.12.017. Epub 2013 Feb 16.
• [22] An exome-wide rare variant analysis of Korean men identifies three novel genes predisposing to prostate cancer.Sci Rep. 2019 Nov 20;9(1):17173. doi: 10.1038/s41598-019-53445-2.
• [23] Identification of pathogenic genes related to rheumatoid arthritis through integrated analysis of DNA methylation and gene expression profiling.Gene. 2017 Nov 15;634:62-67. doi: 10.1016/j.gene.2017.08.032. Epub 2017 Sep 4.
• [24] Genome-wide association study of primary sclerosing cholangitis identifies new risk loci and quantifies the genetic relationship with inflammatory bowel disease.Nat Genet. 2017 Feb;49(2):269-273. doi: 10.1038/ng.3745. Epub 2016 Dec 19.
• [25] Melatonin Regulates Apoptosis and Autophagy Via ROS-MST1 Pathway in Subarachnoid Hemorrhage.Front Mol Neurosci. 2018 Mar 26;11:93. doi: 10.3389/fnmol.2018.00093. eCollection 2018.
• [26] Neratinib protects pancreatic beta cells in diabetes.Nat Commun. 2019 Nov 1;10(1):5015. doi: 10.1038/s41467-019-12880-5.
• [27] Association between ORMDL3, IL1RL1 and a deletion on chromosome 17q21 with asthma risk in Australia.Eur J Hum Genet. 2011 Apr;19(4):458-64. doi: 10.1038/ejhg.2010.191. Epub 2010 Dec 8.
• [28] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [29] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [30] Markers of Hippo-Pathway Activity in Tumor Forming Liver Lesions.Pathol Oncol Res. 2017 Jan;23(1):33-39. doi: 10.1007/s12253-016-0079-0. Epub 2016 Jun 8.
• [31] Characteristics of genomic alterations of lung adenocarcinoma in young never-smokers.Int J Cancer. 2018 Oct 1;143(7):1696-1705. doi: 10.1002/ijc.31542. Epub 2018 May 7.
• [32] Comprehensive analysis of receptor tyrosine kinase activation in human melanomas reveals autocrine signaling through IGF-1R.Melanoma Res. 2011 Aug;21(4):274-84. doi: 10.1097/CMR.0b013e328343a1d6.
• [33] Hippo kinases regulate cell junctions to inhibit tumor metastasis in response to oxidative stress.Redox Biol. 2019 Sep;26:101233. doi: 10.1016/j.redox.2019.101233. Epub 2019 Jun 4.
• [34] Hepatocyte Growth Factor and Macrophage-stimulating Protein "Hinge" Analogs to Treat Pancreatic Cancer.Curr Cancer Drug Targets. 2019;19(10):782-795. doi: 10.2174/1568009619666190326130008.
• [35] Analysis of five chronic inflammatory diseases identifies 27 new associations and highlights disease-specific patterns at shared loci.Nat Genet. 2016 May;48(5):510-8. doi: 10.1038/ng.3528. Epub 2016 Mar 14.
• [36] Genome-wide association study implicates immune activation of multiple integrin genes in inflammatory bowel disease.Nat Genet. 2017 Feb;49(2):256-261. doi: 10.1038/ng.3760. Epub 2017 Jan 9.
• [37] Nicorandil alleviates myocardial injury and post-infarction cardiac remodeling by inhibiting Mst1.Biochem Biophys Res Commun. 2018 Jan 1;495(1):292-299. doi: 10.1016/j.bbrc.2017.11.041. Epub 2017 Nov 7.
• [38] Differential screening of a human chromosome 3 library identifies hepatocyte growth factor-like/macrophage-stimulating protein and its receptor in injured lung. Possible implications for neuroendocrine cell survival.J Clin Invest. 1997 Jun 15;99(12):2979-91. doi: 10.1172/JCI119493.
• [39] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [40] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [41] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [44] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [45] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [46] The antipsychotic chlorpromazine suppresses YAP signaling, stemness properties, and drug resistance in breast cancer cells. Chem Biol Interact. 2019 Apr 1;302:28-35. doi: 10.1016/j.cbi.2019.01.033. Epub 2019 Jan 28.
• [47] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [48] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [49] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.