General Information of Drug Off-Target (DOT) (ID: OTPJ7LX4)

DOT Name Medium-wave-sensitive opsin 1 (OPN1MW)
Synonyms Green cone photoreceptor pigment; Green-sensitive opsin; GOP
Gene Name OPN1MW
Related Disease
Blue cone monochromacy ( )
Cognitive impairment ( )
Melanoma ( )
Non-insulin dependent diabetes ( )
Advanced cancer ( )
Alopecia ( )
Alzheimer disease ( )
Analgesia ( )
Autism spectrum disorder ( )
Beta thalassemia ( )
Burkitt lymphoma ( )
Cardiac failure ( )
Cholangitis ( )
Cholecystitis ( )
Cholelithiasis ( )
Cone dystrophy ( )
Cone-rod dystrophy 2 ( )
Congestive heart failure ( )
Dravet syndrome ( )
Emery-Dreifuss muscular dystrophy ( )
Epilepsy ( )
Hepatocellular carcinoma ( )
Metastatic malignant neoplasm ( )
Myotonic dystrophy ( )
Neoplasm ( )
Neuralgia ( )
Obesity ( )
Overactive bladder ( )
Parkinson disease ( )
Pick disease ( )
Pulmonary disease ( )
Red-green color blindness ( )
Sarcoidosis ( )
Schizophrenia ( )
Tauopathy ( )
Colorectal carcinoma ( )
Gingivitis ( )
Lipid metabolism disorder ( )
Multiple sclerosis ( )
Stroke ( )
Cone-rod dystrophy ( )
Migraine disorder ( )
Lafora disease ( )
Obstructive jaundice ( )
Progressive supranuclear palsy ( )
Tuberous sclerosis ( )
Type-1/2 diabetes ( )
UniProt ID
OPSG_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00001
Sequence
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM
IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFV
LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA
AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYL
QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFH
PLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS
VSPA
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Tissue Specificity The three color pigments are found in the cone photoreceptor cells.
Reactome Pathway
Retinoid cycle disease events (R-HSA-2453864 )
G alpha (i) signalling events (R-HSA-418594 )
Opsins (R-HSA-419771 )
The retinoid cycle in cones (daylight vision) (R-HSA-2187335 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Blue cone monochromacy DISYV7KB Definitive Mitochondrial [1]
Cognitive impairment DISH2ERD Definitive Biomarker [2]
Melanoma DIS1RRCY Definitive Biomarker [3]
Non-insulin dependent diabetes DISK1O5Z Definitive Biomarker [4]
Advanced cancer DISAT1Z9 Strong Genetic Variation [5]
Alopecia DIS37HU4 Strong Biomarker [6]
Alzheimer disease DISF8S70 Strong Biomarker [7]
Analgesia DISK3TVI Strong Biomarker [8]
Autism spectrum disorder DISXK8NV Strong Biomarker [9]
Beta thalassemia DIS5RCQK Strong Genetic Variation [10]
Burkitt lymphoma DIS9D5XU Strong Biomarker [11]
Cardiac failure DISDC067 Strong Biomarker [12]
Cholangitis DIS9U3YN Strong Biomarker [13]
Cholecystitis DISG024R Strong Biomarker [14]
Cholelithiasis DISERLZB Strong Genetic Variation [15]
Cone dystrophy DIS7SAZZ Strong Genetic Variation [16]
Cone-rod dystrophy 2 DISX2RWY Strong GermlineCausalMutation [17]
Congestive heart failure DIS32MEA Strong Biomarker [12]
Dravet syndrome DISJF7LY Strong Biomarker [18]
Emery-Dreifuss muscular dystrophy DISYTPR5 Strong Biomarker [19]
Epilepsy DISBB28L Strong Biomarker [18]
Hepatocellular carcinoma DIS0J828 Strong Genetic Variation [20]
Metastatic malignant neoplasm DIS86UK6 Strong Genetic Variation [20]
Myotonic dystrophy DISNBEMX Strong Biomarker [21]
Neoplasm DISZKGEW Strong Biomarker [22]
Neuralgia DISWO58J Strong Biomarker [23]
Obesity DIS47Y1K Strong Biomarker [24]
Overactive bladder DISQR5TD Strong Biomarker [25]
Parkinson disease DISQVHKL Strong Biomarker [26]
Pick disease DISP6X50 Strong Biomarker [27]
Pulmonary disease DIS6060I Strong Biomarker [28]
Red-green color blindness DISV3ZVU Strong X-linked [29]
Sarcoidosis DISE5B8Z Strong Altered Expression [30]
Schizophrenia DISSRV2N Strong Altered Expression [31]
Tauopathy DISY2IPA Strong Genetic Variation [32]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [33]
Gingivitis DISC8RMX moderate Biomarker [34]
Lipid metabolism disorder DISEOA7S moderate Altered Expression [35]
Multiple sclerosis DISB2WZI moderate Biomarker [25]
Stroke DISX6UHX moderate Biomarker [36]
Cone-rod dystrophy DISY9RWN Supportive Autosomal dominant [17]
Migraine disorder DISFCQTG Disputed Biomarker [37]
Lafora disease DIS83JHH Limited Biomarker [38]
Obstructive jaundice DIS2FDOT Limited Biomarker [39]
Progressive supranuclear palsy DISO5KRQ Limited Biomarker [40]
Tuberous sclerosis DISEMUGZ Limited Biomarker [22]
Type-1/2 diabetes DISIUHAP Limited Biomarker [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Medium-wave-sensitive opsin 1 (OPN1MW). [42]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Medium-wave-sensitive opsin 1 (OPN1MW). [44]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Folic acid DMEMBJC Approved Folic acid decreases the expression of Medium-wave-sensitive opsin 1 (OPN1MW). [43]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Medium-wave-sensitive opsin 1 (OPN1MW). [45]
------------------------------------------------------------------------------------

References

1 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
2 Cannabinoids and Vanilloids in Schizophrenia: Neurophysiological Evidence and Directions for Basic Research.Front Pharmacol. 2017 Jun 21;8:399. doi: 10.3389/fphar.2017.00399. eCollection 2017.
3 Photothermal therapy mediated by phase-transformation nanoparticles facilitates delivery of anti-PD1 antibody and synergizes with antitumor immunotherapy for melanoma.J Control Release. 2019 Jul 28;306:15-28. doi: 10.1016/j.jconrel.2019.05.036. Epub 2019 May 25.
4 Comparison of Great Curvature Plication with Duodenal-Jejunal Bypass (GCP-DJB) and Sleeve Gastrectomy (SG) on Metabolic Indices and Gut Hormones in Type 2 Diabetes Mellitus Rats.Obes Surg. 2018 Dec;28(12):4014-4021. doi: 10.1007/s11695-018-3459-6.
5 Gene polymorphisms of folate metabolizing enzymes and the risk of gastric cancer.Cancer Lett. 2007 Jun 28;251(2):228-36. doi: 10.1016/j.canlet.2006.11.021. Epub 2007 Jan 8.
6 Treatment and prevention of chemotherapy-induced alopecia with PTH-CBD, a collagen-targeted parathyroid hormone analog, in a non-depilated mouse model.Anticancer Drugs. 2014 Jan;25(1):30-8. doi: 10.1097/CAD.0b013e3283650bff.
7 CSF biomarkers -amyloid, tau proteins and a-synuclein in the differential diagnosis of Parkinson-plus syndromes.J Neurol Sci. 2017 Nov 15;382:91-95. doi: 10.1016/j.jns.2017.09.039. Epub 2017 Sep 28.
8 Involvement of glycine receptor 1 subunits in cannabinoid-induced analgesia.Neuropharmacology. 2018 May 1;133:224-232. doi: 10.1016/j.neuropharm.2018.01.041. Epub 2018 Feb 1.
9 Brief Report: Cannabidiol-Rich Cannabis in Children with Autism Spectrum Disorder and Severe Behavioral Problems-A Retrospective Feasibility Study.J Autism Dev Disord. 2019 Mar;49(3):1284-1288. doi: 10.1007/s10803-018-3808-2.
10 Rare beta-thalassemia mutations in Asian Indians.Am J Hematol. 2000 Dec;65(4):322-3. doi: 10.1002/1096-8652(200012)65:4<322::aid-ajh14>3.0.co;2-2.
11 The evaluation of Cannabidiol's effect on the immunotherapy of Burkitt lymphoma. Biochem Biophys Res Commun. 2019 Nov 26;520(1):225-230. doi: 10.1016/j.bbrc.2019.10.001. Epub 2019 Oct 3.
12 Cardiac overexpression of the norepinephrine transporter uptake-1 results in marked improvement of heart failure.Circ Res. 2005 Oct 28;97(9):928-36. doi: 10.1161/01.RES.0000186685.46829.E5. Epub 2005 Sep 15.
13 Retrospective analysis of cases with an ectopic opening of the common bile duct into duodenal bulb.Adv Clin Exp Med. 2018 Oct;27(10):1361-1364. doi: 10.17219/acem/69691.
14 Predicting the difficult laparoscopic cholecystectomy: development and validation of a pre-operative risk score using an objective operative difficulty grading system.Surg Endosc. 2020 Oct;34(10):4549-4561. doi: 10.1007/s00464-019-07244-5. Epub 2019 Nov 15.
15 Laparo-endoscopic rendez-vous versus sequential "delayed" approach in patients with choledocholithiasis.Minerva Chir. 2017 Apr;72(2):98-102. doi: 10.23736/S0026-4733.16.07248-5. Epub 2016 Dec 16.
16 De novo intrachromosomal gene conversion from OPN1MW to OPN1LW in the male germline results in Blue Cone Monochromacy.Sci Rep. 2016 Jun 24;6:28253. doi: 10.1038/srep28253.
17 X-linked cone dystrophy caused by mutation of the red and green cone opsins. Am J Hum Genet. 2010 Jul 9;87(1):26-39. doi: 10.1016/j.ajhg.2010.05.019. Epub 2010 Jun 24.
18 The potential role of cannabinoids in epilepsy treatment.Expert Rev Neurother. 2017 Nov;17(11):1069-1079. doi: 10.1080/14737175.2017.1373019. Epub 2017 Sep 4.
19 Linkage of Emery-Dreifuss muscular dystrophy to the red/green cone pigment (RGCP) genes, proximal to factor VIII.Neuromuscul Disord. 1992;2(1):51-7. doi: 10.1016/0960-8966(92)90027-4.
20 Inhibition of hepatocarcinoma and tumor metastasis to liver by gene therapy with recombinant CBD-HepII polypeptide of fibronectin.Int J Cancer. 2007 Jul 1;121(1):184-92. doi: 10.1002/ijc.22644.
21 A role for cannabinoids in the treatment of myotonia? Report of compassionate use in a small cohort of patients.J Neurol. 2020 Feb;267(2):415-421. doi: 10.1007/s00415-019-09593-6. Epub 2019 Oct 26.
22 Cannabidiol modulates phosphorylated rpS6 signalling in a zebrafish model of Tuberous Sclerosis Complex.Behav Brain Res. 2019 May 2;363:135-144. doi: 10.1016/j.bbr.2019.01.040. Epub 2019 Jan 23.
23 Cannabinoids in Pain Management and Palliative Medicine.Dtsch Arztebl Int. 2017 Sep 22;114(38):627-634. doi: 10.3238/arztebl.2017.0627.
24 Greater Curvature Plication with Duodenal-Jejunal Bypass: a Novel Metabolic Surgery for Type 2 Diabetes Mellitus.Obes Surg. 2018 Jun;28(6):1595-1601. doi: 10.1007/s11695-017-3057-z.
25 THC/CBD oromucosal spray in patients with multiple sclerosis overactive bladder: a pilot prospective study.Neurol Sci. 2018 Jan;39(1):97-102. doi: 10.1007/s10072-017-3148-6. Epub 2017 Oct 19.
26 Transcranial sonography in atypical parkinsonism: How reliable is it in real clinical practice? A multicentre comprehensive study.Parkinsonism Relat Disord. 2019 Nov;68:40-45. doi: 10.1016/j.parkreldis.2019.09.032. Epub 2019 Oct 1.
27 A novel MAPT mutation, G55R, in a frontotemporal dementia patient leads to altered Tau function.PLoS One. 2013 Sep 27;8(9):e76409. doi: 10.1371/journal.pone.0076409. eCollection 2013.
28 Update on metal-induced occupational lung disease.Curr Opin Allergy Clin Immunol. 2018 Apr;18(2):73-79. doi: 10.1097/ACI.0000000000000420.
29 Analysis of L-cone/M-cone visual pigment gene arrays in Japanese males with protan color-vision deficiency. Vision Res. 2004;44(19):2241-52. doi: 10.1016/j.visres.2004.04.011.
30 Beryllium-induced lung disease exhibits expression profiles similar to sarcoidosis.Eur Respir J. 2016 Jun;47(6):1797-808. doi: 10.1183/13993003.01469-2015. Epub 2016 Apr 21.
31 Cannabidiol Administered During Peri-Adolescence Prevents Behavioral Abnormalities in an Animal Model of Schizophrenia.Front Pharmacol. 2018 Aug 21;9:901. doi: 10.3389/fphar.2018.00901. eCollection 2018.
32 Novel mutation in MAPT exon 13 (p.N410H) causes corticobasal degeneration.Acta Neuropathol. 2014 Feb;127(2):271-82. doi: 10.1007/s00401-013-1193-7.
33 Potential Applications of DNA, RNA and Protein Biomarkers in Diagnosis, Therapy and Prognosis for Colorectal Cancer: A Study from Databases to AI-Assisted Verification.Cancers (Basel). 2019 Feb 1;11(2):172. doi: 10.3390/cancers11020172.
34 The effect of nonsurgical periodontal treatment on gingival crevicular fluid stress hormone levels: A prospective study.Oral Dis. 2019 Jan;25(1):250-257. doi: 10.1111/odi.12973. Epub 2018 Sep 27.
35 4-O-Sulfation in sea cucumber fucodians contribute to reversing dyslipidiaemia caused by HFD.Int J Biol Macromol. 2017 Jun;99:96-104. doi: 10.1016/j.ijbiomac.2017.01.145. Epub 2017 Feb 1.
36 A randomised controlled cross-over double-blind pilot study protocol on THC:CBD oromucosal spray efficacy as an add-on therapy for post-stroke spasticity.BMJ Open. 2017 Sep 7;7(9):e016843. doi: 10.1136/bmjopen-2017-016843.
37 Short- and Long-Term Effects of Cannabis on Headache and Migraine.J Pain. 2020 May-Jun;21(5-6):722-730. doi: 10.1016/j.jpain.2019.11.001. Epub 2019 Nov 9.
38 Corticobasal syndrome with visual hallucinations and probable REM-sleep behavior disorder: an autopsied case report of a patient with CBD and LBD pathology.Neurocase. 2019 Feb-Apr;25(1-2):26-33. doi: 10.1080/13554794.2019.1604973. Epub 2019 Apr 22.
39 Endoscopic papillary large balloon dilatation for the extraction of common bile duct stones.Rev Esp Enferm Dig. 2019 May;111(5):358-363. doi: 10.17235/reed.2019.5865/2018.
40 Non-Alzheimer's disease dementias: anatomic, clinical, and molecular correlates.Can J Psychiatry. 2004 Mar;49(3):164-71. doi: 10.1177/070674370404900303.
41 Combined GLP-1, Oxyntomodulin, and Peptide YY Improves Body Weight and Glycemia in Obesity and Prediabetes/Type 2 Diabetes: A Randomized, Single-Blinded, Placebo-Controlled Study.Diabetes Care. 2019 Aug;42(8):1446-1453. doi: 10.2337/dc19-0449. Epub 2019 Jun 8.
42 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
43 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
44 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
45 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.