Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPJ7LX4)

DOT Name	Medium-wave-sensitive opsin 1 (OPN1MW)
Synonyms	Green cone photoreceptor pigment; Green-sensitive opsin; GOP
Gene Name	OPN1MW
Related Disease	Blue cone monochromacy ( ) Cognitive impairment ( ) Melanoma ( ) Non-insulin dependent diabetes ( ) Advanced cancer ( ) Alopecia ( ) Alzheimer disease ( ) Analgesia ( ) Autism spectrum disorder ( ) Beta thalassemia ( ) Burkitt lymphoma ( ) Cardiac failure ( ) Cholangitis ( ) Cholecystitis ( ) Cholelithiasis ( ) Cone dystrophy ( ) Cone-rod dystrophy 2 ( ) Congestive heart failure ( ) Dravet syndrome ( ) Emery-Dreifuss muscular dystrophy ( ) Epilepsy ( ) Hepatocellular carcinoma ( ) Metastatic malignant neoplasm ( ) Myotonic dystrophy ( ) Neoplasm ( ) Neuralgia ( ) Obesity ( ) Overactive bladder ( ) Parkinson disease ( ) Pick disease ( ) Pulmonary disease ( ) Red-green color blindness ( ) Sarcoidosis ( ) Schizophrenia ( ) Tauopathy ( ) Colorectal carcinoma ( ) Gingivitis ( ) Lipid metabolism disorder ( ) Multiple sclerosis ( ) Stroke ( ) Cone-rod dystrophy ( ) Migraine disorder ( ) Lafora disease ( ) Obstructive jaundice ( ) Progressive supranuclear palsy ( ) Tuberous sclerosis ( ) Type-1/2 diabetes ( )
UniProt ID	OPSG_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00001
Sequence	MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFV LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFH PLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS VSPA
Function	Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Tissue Specificity	The three color pigments are found in the cone photoreceptor cells.
Reactome Pathway	Retinoid cycle disease events (R-HSA-2453864 ) G alpha (i) signalling events (R-HSA-418594 ) Opsins (R-HSA-419771 ) The retinoid cycle in cones (daylight vision) (R-HSA-2187335 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Blue cone monochromacy	DISYV7KB	Definitive	Mitochondrial	[1]
Cognitive impairment	DISH2ERD	Definitive	Biomarker	[2]
Melanoma	DIS1RRCY	Definitive	Biomarker	[3]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[5]
Alopecia	DIS37HU4	Strong	Biomarker	[6]
Alzheimer disease	DISF8S70	Strong	Biomarker	[7]
Analgesia	DISK3TVI	Strong	Biomarker	[8]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[9]
Beta thalassemia	DIS5RCQK	Strong	Genetic Variation	[10]
Burkitt lymphoma	DIS9D5XU	Strong	Biomarker	[11]
Cardiac failure	DISDC067	Strong	Biomarker	[12]
Cholangitis	DIS9U3YN	Strong	Biomarker	[13]
Cholecystitis	DISG024R	Strong	Biomarker	[14]
Cholelithiasis	DISERLZB	Strong	Genetic Variation	[15]
Cone dystrophy	DIS7SAZZ	Strong	Genetic Variation	[16]
Cone-rod dystrophy 2	DISX2RWY	Strong	GermlineCausalMutation	[17]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[12]
Dravet syndrome	DISJF7LY	Strong	Biomarker	[18]
Emery-Dreifuss muscular dystrophy	DISYTPR5	Strong	Biomarker	[19]
Epilepsy	DISBB28L	Strong	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[20]
Metastatic malignant neoplasm	DIS86UK6	Strong	Genetic Variation	[20]
Myotonic dystrophy	DISNBEMX	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Neuralgia	DISWO58J	Strong	Biomarker	[23]
Obesity	DIS47Y1K	Strong	Biomarker	[24]
Overactive bladder	DISQR5TD	Strong	Biomarker	[25]
Parkinson disease	DISQVHKL	Strong	Biomarker	[26]
Pick disease	DISP6X50	Strong	Biomarker	[27]
Pulmonary disease	DIS6060I	Strong	Biomarker	[28]
Red-green color blindness	DISV3ZVU	Strong	X-linked	[29]
Sarcoidosis	DISE5B8Z	Strong	Altered Expression	[30]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[31]
Tauopathy	DISY2IPA	Strong	Genetic Variation	[32]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[33]
Gingivitis	DISC8RMX	moderate	Biomarker	[34]
Lipid metabolism disorder	DISEOA7S	moderate	Altered Expression	[35]
Multiple sclerosis	DISB2WZI	moderate	Biomarker	[25]
Stroke	DISX6UHX	moderate	Biomarker	[36]
Cone-rod dystrophy	DISY9RWN	Supportive	Autosomal dominant	[17]
Migraine disorder	DISFCQTG	Disputed	Biomarker	[37]
Lafora disease	DIS83JHH	Limited	Biomarker	[38]
Obstructive jaundice	DIS2FDOT	Limited	Biomarker	[39]
Progressive supranuclear palsy	DISO5KRQ	Limited	Biomarker	[40]
Tuberous sclerosis	DISEMUGZ	Limited	Biomarker	[22]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[41]
------------------------------------------------------------------------------------


⏷ Show the Full List of 47 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Medium-wave-sensitive opsin 1 (OPN1MW).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Medium-wave-sensitive opsin 1 (OPN1MW).	[44]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Medium-wave-sensitive opsin 1 (OPN1MW).	[43]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Medium-wave-sensitive opsin 1 (OPN1MW).	[45]
------------------------------------------------------------------------------------

References

1	Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
2	Cannabinoids and Vanilloids in Schizophrenia: Neurophysiological Evidence and Directions for Basic Research.Front Pharmacol. 2017 Jun 21;8:399. doi: 10.3389/fphar.2017.00399. eCollection 2017.
3	Photothermal therapy mediated by phase-transformation nanoparticles facilitates delivery of anti-PD1 antibody and synergizes with antitumor immunotherapy for melanoma.J Control Release. 2019 Jul 28;306:15-28. doi: 10.1016/j.jconrel.2019.05.036. Epub 2019 May 25.
4	Comparison of Great Curvature Plication with Duodenal-Jejunal Bypass (GCP-DJB) and Sleeve Gastrectomy (SG) on Metabolic Indices and Gut Hormones in Type 2 Diabetes Mellitus Rats.Obes Surg. 2018 Dec;28(12):4014-4021. doi: 10.1007/s11695-018-3459-6.
5	Gene polymorphisms of folate metabolizing enzymes and the risk of gastric cancer.Cancer Lett. 2007 Jun 28;251(2):228-36. doi: 10.1016/j.canlet.2006.11.021. Epub 2007 Jan 8.
6	Treatment and prevention of chemotherapy-induced alopecia with PTH-CBD, a collagen-targeted parathyroid hormone analog, in a non-depilated mouse model.Anticancer Drugs. 2014 Jan;25(1):30-8. doi: 10.1097/CAD.0b013e3283650bff.
7	CSF biomarkers -amyloid, tau proteins and a-synuclein in the differential diagnosis of Parkinson-plus syndromes.J Neurol Sci. 2017 Nov 15;382:91-95. doi: 10.1016/j.jns.2017.09.039. Epub 2017 Sep 28.
8	Involvement of glycine receptor 1 subunits in cannabinoid-induced analgesia.Neuropharmacology. 2018 May 1;133:224-232. doi: 10.1016/j.neuropharm.2018.01.041. Epub 2018 Feb 1.
9	Brief Report: Cannabidiol-Rich Cannabis in Children with Autism Spectrum Disorder and Severe Behavioral Problems-A Retrospective Feasibility Study.J Autism Dev Disord. 2019 Mar;49(3):1284-1288. doi: 10.1007/s10803-018-3808-2.
10	Rare beta-thalassemia mutations in Asian Indians.Am J Hematol. 2000 Dec;65(4):322-3. doi: 10.1002/1096-8652(200012)65:4<322::aid-ajh14>3.0.co;2-2.
11	The evaluation of Cannabidiol's effect on the immunotherapy of Burkitt lymphoma. Biochem Biophys Res Commun. 2019 Nov 26;520(1):225-230. doi: 10.1016/j.bbrc.2019.10.001. Epub 2019 Oct 3.
12	Cardiac overexpression of the norepinephrine transporter uptake-1 results in marked improvement of heart failure.Circ Res. 2005 Oct 28;97(9):928-36. doi: 10.1161/01.RES.0000186685.46829.E5. Epub 2005 Sep 15.
13	Retrospective analysis of cases with an ectopic opening of the common bile duct into duodenal bulb.Adv Clin Exp Med. 2018 Oct;27(10):1361-1364. doi: 10.17219/acem/69691.
14	Predicting the difficult laparoscopic cholecystectomy: development and validation of a pre-operative risk score using an objective operative difficulty grading system.Surg Endosc. 2020 Oct;34(10):4549-4561. doi: 10.1007/s00464-019-07244-5. Epub 2019 Nov 15.
15	Laparo-endoscopic rendez-vous versus sequential "delayed" approach in patients with choledocholithiasis.Minerva Chir. 2017 Apr;72(2):98-102. doi: 10.23736/S0026-4733.16.07248-5. Epub 2016 Dec 16.
16	De novo intrachromosomal gene conversion from OPN1MW to OPN1LW in the male germline results in Blue Cone Monochromacy.Sci Rep. 2016 Jun 24;6:28253. doi: 10.1038/srep28253.
17	X-linked cone dystrophy caused by mutation of the red and green cone opsins. Am J Hum Genet. 2010 Jul 9;87(1):26-39. doi: 10.1016/j.ajhg.2010.05.019. Epub 2010 Jun 24.
18	The potential role of cannabinoids in epilepsy treatment.Expert Rev Neurother. 2017 Nov;17(11):1069-1079. doi: 10.1080/14737175.2017.1373019. Epub 2017 Sep 4.
19	Linkage of Emery-Dreifuss muscular dystrophy to the red/green cone pigment (RGCP) genes, proximal to factor VIII.Neuromuscul Disord. 1992;2(1):51-7. doi: 10.1016/0960-8966(92)90027-4.
20	Inhibition of hepatocarcinoma and tumor metastasis to liver by gene therapy with recombinant CBD-HepII polypeptide of fibronectin.Int J Cancer. 2007 Jul 1;121(1):184-92. doi: 10.1002/ijc.22644.
21	A role for cannabinoids in the treatment of myotonia? Report of compassionate use in a small cohort of patients.J Neurol. 2020 Feb;267(2):415-421. doi: 10.1007/s00415-019-09593-6. Epub 2019 Oct 26.
22	Cannabidiol modulates phosphorylated rpS6 signalling in a zebrafish model of Tuberous Sclerosis Complex.Behav Brain Res. 2019 May 2;363:135-144. doi: 10.1016/j.bbr.2019.01.040. Epub 2019 Jan 23.
23	Cannabinoids in Pain Management and Palliative Medicine.Dtsch Arztebl Int. 2017 Sep 22;114(38):627-634. doi: 10.3238/arztebl.2017.0627.
24	Greater Curvature Plication with Duodenal-Jejunal Bypass: a Novel Metabolic Surgery for Type 2 Diabetes Mellitus.Obes Surg. 2018 Jun;28(6):1595-1601. doi: 10.1007/s11695-017-3057-z.
25	THC/CBD oromucosal spray in patients with multiple sclerosis overactive bladder: a pilot prospective study.Neurol Sci. 2018 Jan;39(1):97-102. doi: 10.1007/s10072-017-3148-6. Epub 2017 Oct 19.
26	Transcranial sonography in atypical parkinsonism: How reliable is it in real clinical practice? A multicentre comprehensive study.Parkinsonism Relat Disord. 2019 Nov;68:40-45. doi: 10.1016/j.parkreldis.2019.09.032. Epub 2019 Oct 1.
27	A novel MAPT mutation, G55R, in a frontotemporal dementia patient leads to altered Tau function.PLoS One. 2013 Sep 27;8(9):e76409. doi: 10.1371/journal.pone.0076409. eCollection 2013.
28	Update on metal-induced occupational lung disease.Curr Opin Allergy Clin Immunol. 2018 Apr;18(2):73-79. doi: 10.1097/ACI.0000000000000420.
29	Analysis of L-cone/M-cone visual pigment gene arrays in Japanese males with protan color-vision deficiency. Vision Res. 2004;44(19):2241-52. doi: 10.1016/j.visres.2004.04.011.
30	Beryllium-induced lung disease exhibits expression profiles similar to sarcoidosis.Eur Respir J. 2016 Jun;47(6):1797-808. doi: 10.1183/13993003.01469-2015. Epub 2016 Apr 21.
31	Cannabidiol Administered During Peri-Adolescence Prevents Behavioral Abnormalities in an Animal Model of Schizophrenia.Front Pharmacol. 2018 Aug 21;9:901. doi: 10.3389/fphar.2018.00901. eCollection 2018.
32	Novel mutation in MAPT exon 13 (p.N410H) causes corticobasal degeneration.Acta Neuropathol. 2014 Feb;127(2):271-82. doi: 10.1007/s00401-013-1193-7.
33	Potential Applications of DNA, RNA and Protein Biomarkers in Diagnosis, Therapy and Prognosis for Colorectal Cancer: A Study from Databases to AI-Assisted Verification.Cancers (Basel). 2019 Feb 1;11(2):172. doi: 10.3390/cancers11020172.
34	The effect of nonsurgical periodontal treatment on gingival crevicular fluid stress hormone levels: A prospective study.Oral Dis. 2019 Jan;25(1):250-257. doi: 10.1111/odi.12973. Epub 2018 Sep 27.
35	4-O-Sulfation in sea cucumber fucodians contribute to reversing dyslipidiaemia caused by HFD.Int J Biol Macromol. 2017 Jun;99:96-104. doi: 10.1016/j.ijbiomac.2017.01.145. Epub 2017 Feb 1.
36	A randomised controlled cross-over double-blind pilot study protocol on THC:CBD oromucosal spray efficacy as an add-on therapy for post-stroke spasticity.BMJ Open. 2017 Sep 7;7(9):e016843. doi: 10.1136/bmjopen-2017-016843.
37	Short- and Long-Term Effects of Cannabis on Headache and Migraine.J Pain. 2020 May-Jun;21(5-6):722-730. doi: 10.1016/j.jpain.2019.11.001. Epub 2019 Nov 9.
38	Corticobasal syndrome with visual hallucinations and probable REM-sleep behavior disorder: an autopsied case report of a patient with CBD and LBD pathology.Neurocase. 2019 Feb-Apr;25(1-2):26-33. doi: 10.1080/13554794.2019.1604973. Epub 2019 Apr 22.
39	Endoscopic papillary large balloon dilatation for the extraction of common bile duct stones.Rev Esp Enferm Dig. 2019 May;111(5):358-363. doi: 10.17235/reed.2019.5865/2018.
40	Non-Alzheimer's disease dementias: anatomic, clinical, and molecular correlates.Can J Psychiatry. 2004 Mar;49(3):164-71. doi: 10.1177/070674370404900303.
41	Combined GLP-1, Oxyntomodulin, and Peptide YY Improves Body Weight and Glycemia in Obesity and Prediabetes/Type 2 Diabetes: A Randomized, Single-Blinded, Placebo-Controlled Study.Diabetes Care. 2019 Aug;42(8):1446-1453. doi: 10.2337/dc19-0449. Epub 2019 Jun 8.
42	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
43	Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
44	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
45	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.