Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRZ3OMY)

• DOT Name: Cytokine receptor common subunit gamma (IL2RG)
• Synonyms: Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132
• Gene Name: IL2RG
• Related Disease:
  T lymphoblastic leukaemia
  T-B+ severe combined immunodeficiency due to gamma chain deficiency
  T-cell lymphoma
  Acute monocytic leukemia
  Adult T-cell leukemia/lymphoma
  Age-related macular degeneration
  Ankylosing spondylitis
  Ataxia-telangiectasia
  Autoimmune disease
  Brain neoplasm
  Bruton-type agammaglobulinemia
  Cataract
  Chronic myelomonocytic leukaemia
  Colon cancer
  Colon carcinoma
  Graft-versus-host disease
  Her2-receptor negative breast cancer
  HER2/NEU overexpressing breast cancer
  HIV infectious disease
  Inborn error of immunity
  leukaemia
  Leukemia
  Melanoma
  Metastatic malignant neoplasm
  Non-hodgkin lymphoma
  Osteoarthritis
  Pelvic inflammatory disease
  Plasma cell myeloma
  Primary cutaneous peripheral T-cell lymphoma not otherwise specified
  Retinopathy
  Rheumatoid arthritis
  Schizophrenia
  Sezary syndrome
  Small lymphocytic lymphoma
  Thymus lymphoma
  Triple negative breast cancer
  West syndrome
  Wiskott-Aldrich syndrome
  X-linked lymphoproliferative syndrome
  Omenn syndrome
  Primary cutaneous T-cell lymphoma
  Acute respiratory failure
  Colorectal carcinoma
  Meningitis
  Neoplasm
  Rheumatic fever
  T-cell leukaemia
• UniProt ID: IL2RG_HUMAN
• PDB ID: 2B5I; 2ERJ; 3BPL; 3QAZ; 3QB7; 4GS7; 5M5E; 6OEL; 7S2R; 8ENT; 8EPA
• Pfam ID: PF21605 ; PF21604
• Sequence:
  MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
  QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
  EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
  HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
  SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
  TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
  PCYTLKPET
• Function: Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Endocytosis (hsa04144)
  PI3K-Akt sig.ling pathway (hsa04151)
  JAK-STAT sig.ling pathway (hsa04630)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  Measles (hsa05162)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Pathways in cancer (hsa05200)
  Inflammatory bowel disease (hsa05321)
  Primary immunodeficiency (hsa05340)
• Reactome Pathway:
  RAF/MAP kinase cascade (R-HSA-5673001)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Interleukin-15 signaling (R-HSA-8983432)
  Interleukin-9 signaling (R-HSA-8985947)
  Interleukin-2 signaling (R-HSA-9020558)
  Interleukin-21 signaling (R-HSA-9020958)
  Interleukin receptor SHC signaling (R-HSA-912526)
  STAT3 nuclear events downstream of ALK signaling (R-HSA-9701898)
  Interleukin-7 signaling (R-HSA-1266695)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
T lymphoblastic leukaemia	DIS2PNPP	Definitive	Altered Expression	[1]
T-B+ severe combined immunodeficiency due to gamma chain deficiency	DISDB6K2	Definitive	X-linked	[2]
T-cell lymphoma	DISSXRTQ	Definitive	Biomarker	[3]
Acute monocytic leukemia	DIS28NEL	Strong	Altered Expression	[4]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Altered Expression	[5]
Age-related macular degeneration	DIS0XS2C	Strong	Genetic Variation	[6]
Ankylosing spondylitis	DISRC6IR	Strong	Biomarker	[7]
Ataxia-telangiectasia	DISP3EVR	Strong	Genetic Variation	[8]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[9]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[10]
Bruton-type agammaglobulinemia	DISQ5ZYP	Strong	Genetic Variation	[11]
Cataract	DISUD7SL	Strong	Genetic Variation	[12]
Chronic myelomonocytic leukaemia	DISDN5P7	Strong	Biomarker	[13]
Colon cancer	DISVC52G	Strong	Biomarker	[14]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[14]
Graft-versus-host disease	DIS0QADF	Strong	Genetic Variation	[15]
Her2-receptor negative breast cancer	DISS605N	Strong	Altered Expression	[16]
HER2/NEU overexpressing breast cancer	DISYKID5	Strong	Altered Expression	[16]
HIV infectious disease	DISO97HC	Strong	Biomarker	[17]
Inborn error of immunity	DISNGCMN	Strong	Genetic Variation	[18]
leukaemia	DISS7D1V	Strong	Altered Expression	[19]
Leukemia	DISNAKFL	Strong	Altered Expression	[19]
Melanoma	DIS1RRCY	Strong	Biomarker	[20]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[21]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[4]
Osteoarthritis	DIS05URM	Strong	Biomarker	[7]
Pelvic inflammatory disease	DISWQR4J	Strong	Genetic Variation	[18]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[22]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified	DIS5OHQF	Strong	Altered Expression	[23]
Retinopathy	DISB4B0F	Strong	Genetic Variation	[6]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[7]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[24]
Sezary syndrome	DISFMTC7	Strong	Biomarker	[25]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[4]
Thymus lymphoma	DISJ17C5	Strong	Biomarker	[26]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[27]
West syndrome	DISLIAU9	Strong	Genetic Variation	[28]
Wiskott-Aldrich syndrome	DISATMDB	Strong	Biomarker	[29]
X-linked lymphoproliferative syndrome	DISA7MJ4	Strong	Biomarker	[29]
Omenn syndrome	DIS2C887	Supportive	Autosomal recessive	[30]
Primary cutaneous T-cell lymphoma	DIS35WVW	Disputed	Altered Expression	[31]
Acute respiratory failure	DIS5KQ5Y	Limited	Biomarker	[32]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[33]
Meningitis	DISQABAA	Limited	Biomarker	[34]
Neoplasm	DISZKGEW	Limited	Biomarker	[14]
Rheumatic fever	DISLUF66	Limited	Biomarker	[32]
T-cell leukaemia	DISJ6YIF	Limited	Genetic Variation	[35]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cytokine receptor common subunit gamma (IL2RG).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cytokine receptor common subunit gamma (IL2RG).	[37]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Cytokine receptor common subunit gamma (IL2RG).	[38]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Cytokine receptor common subunit gamma (IL2RG).	[39]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Cytokine receptor common subunit gamma (IL2RG).	[41]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline decreases the expression of Cytokine receptor common subunit gamma (IL2RG).	[42]
Dinoprostone	DMTYOPD	Approved	Dinoprostone decreases the expression of Cytokine receptor common subunit gamma (IL2RG).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Marinol	DM70IK5	Approved	Marinol decreases the methylation of Cytokine receptor common subunit gamma (IL2RG).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Cytokine receptor common subunit gamma (IL2RG).	[44]

References

• [1] Integrated genomic sequencing reveals mutational landscape of T-cell prolymphocytic leukemia.Blood. 2014 Aug 28;124(9):1460-72. doi: 10.1182/blood-2014-03-559542. Epub 2014 May 13.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Gene therapy: therapeutic gene causing lymphoma.Nature. 2006 Apr 27;440(7088):1123. doi: 10.1038/4401123a.
• [4] Potential to target dysregulated interleukin-2 receptor expression in canine lymphoid and hematopoietic malignancies as a model for human cancer.J Immunother. 2002 Jan-Feb;25(1):36-45. doi: 10.1097/00002371-200201000-00004.
• [5] Multiple gammac-receptor expression in adult T-cell leukemia.Eur J Haematol. 2002 Jun;68(6):362-9. doi: 10.1034/j.1600-0609.2002.00653.x.
• [6] Exon screening of the genes encoding the beta- and gamma-subunits of cone transducin in patients with inherited retinal disease.Mol Vis. 1998 Sep 17;4:16.
• [7] CD38 and E2F transcription factor 2 have uniquely increased expression in rheumatoid arthritis synovial tissues.Clin Exp Immunol. 2014 May;176(2):222-31. doi: 10.1111/cei.12268.
• [8] Concurrent Mutations in ATM and Genes Associated with Common Chain Signaling in Peripheral T Cell Lymphoma.PLoS One. 2015 Nov 4;10(11):e0141906. doi: 10.1371/journal.pone.0141906. eCollection 2015.
• [9] Human syndromes of immunodeficiency and dysregulation are characterized by distinct defects in T-cell receptor repertoire development.J Allergy Clin Immunol. 2014 Apr;133(4):1109-15. doi: 10.1016/j.jaci.2013.11.018. Epub 2014 Jan 7.
• [10] Interleukin-13 receptor alpha chain: a novel tumor-associated transmembrane protein in primary explants of human malignant gliomas.Cancer Res. 2000 Mar 1;60(5):1168-72.
• [11] Close linkage of the locus for X chromosome-linked severe combined immunodeficiency to polymorphic DNA markers in Xq11-q13.Proc Natl Acad Sci U S A. 1987 Nov;84(21):7576-9. doi: 10.1073/pnas.84.21.7576.
• [12] Conformational change and destabilization of cataract gammaC-crystallin T5P mutant.FEBS Lett. 2002 Feb 27;513(2-3):213-6. doi: 10.1016/s0014-5793(02)02313-x.
• [13] Engraftment of NOD/SCID/gammac(null) mice with multilineage neoplastic cells from patients with juvenile myelomonocytic leukaemia.Br J Haematol. 2005 Jul;130(1):51-7. doi: 10.1111/j.1365-2141.2005.05578.x.
• [14] NOD-scidIl2rg (tm1Wjl) and NOD-Rag1 (null) Il2rg (tm1Wjl) : a model for stromal cell-tumor cell interaction for human colon cancer.Dig Dis Sci. 2014 Jun;59(6):1169-79. doi: 10.1007/s10620-014-3168-5. Epub 2014 May 6.
• [15] Silent IL2RG Gene Editing in Human Pluripotent Stem Cells.Mol Ther. 2016 Mar;24(3):582-91. doi: 10.1038/mt.2015.190. Epub 2015 Oct 7.
• [16] Multiorgan metastasis of human HER-2+ breast cancer in Rag2-/-;Il2rg-/- mice and treatment with PI3K inhibitor.PLoS One. 2012;7(6):e39626. doi: 10.1371/journal.pone.0039626. Epub 2012 Jun 21.
• [17] Disruption of the gamma c cytokine network in T cells during HIV infection.Cytokine. 2008 Jul;43(1):1-14. doi: 10.1016/j.cyto.2008.03.001. Epub 2008 Apr 15.
• [18] Novel RAG1 mutation and the occurrence of mycobacterial and Chromobacterium violaceum infections in a case of leaky SCID.Microb Pathog. 2017 Aug;109:114-119. doi: 10.1016/j.micpath.2017.05.033. Epub 2017 May 25.
• [19] CD8?innate-type lymphocytes in the intestinal epithelium mediate mucosal immunity.Immunity. 2014 Sep 18;41(3):451-464. doi: 10.1016/j.immuni.2014.08.010. Epub 2014 Sep 11.
• [20] Human melanoma-initiating cells express neural crest nerve growth factor receptor CD271.Nature. 2010 Jul 1;466(7302):133-7. doi: 10.1038/nature09161.
• [21] High metastatic efficiency of human sarcoma cells in Rag2/gammac double knockout mice provides a powerful test system for antimetastatic targeted therapy.Eur J Cancer. 2010 Feb;46(3):659-68. doi: 10.1016/j.ejca.2009.11.018. Epub 2009 Dec 22.
• [22] Highly activated and expanded natural killer cells for multiple myeloma immunotherapy.Haematologica. 2012 Sep;97(9):1348-56. doi: 10.3324/haematol.2011.056747. Epub 2012 Mar 14.
• [23] Genome profiling revealed the activation of IL2RG/JAK3/STAT5 in peripheral Tcell lymphoma expressing the ITKSYK fusion gene.Int J Oncol. 2019 Nov;55(5):1077-1089. doi: 10.3892/ijo.2019.4882. Epub 2019 Sep 20.
• [24] Chronic schizophrenia is associated with over-expression of the interleukin-2 receptor gamma gene.Psychiatry Res. 2014 Jul 30;217(3):158-62. doi: 10.1016/j.psychres.2014.03.020. Epub 2014 Mar 25.
• [25] Genomic profiling of Szary syndrome identifies alterations of key T cell signaling and differentiation genes.Nat Genet. 2015 Dec;47(12):1426-34. doi: 10.1038/ng.3444. Epub 2015 Nov 9.
• [26] Histopathological characteristics of human non-tumor thyroid tissues in a long-term model of adenomatous goiter xenografts in the NOD/Shi-scid, IL-2R(null) mouse.Exp Toxicol Pathol. 2014 Jul;66(4):203-9. doi: 10.1016/j.etp.2014.01.006. Epub 2014 Feb 28.
• [27] IL15RA drives antagonistic mechanisms of cancer development and immune control in lymphocyte-enriched triple-negative breast cancers.Cancer Res. 2014 Sep 1;74(17):4908-21. doi: 10.1158/0008-5472.CAN-14-0637. Epub 2014 Jun 30.
• [28] Successful treatment for West syndrome with severe combined immunodeficiency.Brain Dev. 2015 Jan;37(1):140-4. doi: 10.1016/j.braindev.2014.01.012. Epub 2014 Feb 15.
• [29] Lentiviral vectors for the treatment of primary immunodeficiencies.J Inherit Metab Dis. 2014 Jul;37(4):525-33. doi: 10.1007/s10545-014-9690-y. Epub 2014 Mar 12.
• [30] Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
• [31] STAT5 induces miR-21 expression in cutaneous T cell lymphoma.Oncotarget. 2016 Jul 19;7(29):45730-45744. doi: 10.18632/oncotarget.10160.
• [32] Unique risk factors for insertional mutagenesis in a mouse model of XSCID gene therapy.Proc Natl Acad Sci U S A. 2006 Aug 1;103(31):11730-5. doi: 10.1073/pnas.0603635103. Epub 2006 Jul 24.
• [33] Non-invasive detection of c-myc p64, c-myc p67 and c-erbb-2 in colorectal cancer.Scand J Gastroenterol. 2005 Nov;40(11):1343-50. doi: 10.1080/00365520510023549.
• [34] CIMAvax-EGF: Toward long-term survival of advanced NSCLC.Semin Oncol. 2018 Jan;45(1-2):34-40. doi: 10.1053/j.seminoncol.2018.04.009. Epub 2018 May 1.
• [35] Murine leukemias with retroviral insertions at Lmo2 are predictive of the leukemias induced in SCID-X1 patients following retroviral gene therapy.PLoS Genet. 2009 May;5(5):e1000491. doi: 10.1371/journal.pgen.1000491. Epub 2009 May 22.
• [36] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [37] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [38] Immediate up-regulation of the calcium-binding protein S100P and its involvement in the cytokinin-induced differentiation of human myeloid leukemia cells. Biochim Biophys Acta. 2005 Sep 10;1745(2):156-65.
• [39] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [40] Epigenetic activation of O-linked -N-acetylglucosamine transferase overrides the differentiation blockage in acute leukemia. EBioMedicine. 2020 Apr;54:102678. doi: 10.1016/j.ebiom.2020.102678. Epub 2020 Apr 6.
• [41] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [42] Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
• [43] Tumor-shed PGE(2) impairs IL2Rgammac-signaling to inhibit CD4 T cell survival: regulation by theaflavins. PLoS One. 2009 Oct 8;4(10):e7382. doi: 10.1371/journal.pone.0007382.
• [44] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.