Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT734JN)

• DOT Name: Staphylococcal nuclease domain-containing protein 1 (SND1)
• Synonyms: EC 3.1.31.1; 100 kDa coactivator; EBNA2 coactivator p100; Tudor domain-containing protein 11; p100 co-activator
• Gene Name: SND1
• Related Disease:
  Autism
  Lung cancer
  Prostate cancer
  Prostate carcinoma
  Alzheimer disease
  Autism spectrum disorder
  B-cell lymphoma
  Bipolar disorder
  Bone osteosarcoma
  Breast neoplasm
  Colitis
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Epilepsy
  Gastric cancer
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Inflammatory bowel disease
  Lung adenocarcinoma
  Lung carcinoma
  Lung neoplasm
  Malignant glioma
  Multiple sclerosis
  Neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Osteosarcoma
  Plasma cell myeloma
  Pneumonia
  Stomach cancer
  Small lymphocytic lymphoma
  Type-1 diabetes
  Adult lymphoma
  Anxiety
  Anxiety disorder
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Colorectal carcinoma
  Glioma
  Liver cancer
  Lymphoma
  Metastatic malignant neoplasm
  Optic neuritis
  Pediatric lymphoma
  Type-1/2 diabetes
• UniProt ID: SND1_HUMAN
• PDB ID: 2E6N; 2HQE; 2HQX; 2O4X; 3BDL; 3OMC; 3OMG; 4QMG; 5M9O; 7KNW; 7KNX
• EC Number: 3.1.31.1
• Pfam ID: PF00565 ; PF00567
• Sequence:
  MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
  RRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
  ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTI
  ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSET
  PEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
  IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKL
  NSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
  YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
  AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
  KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
  MDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAH
  YEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIAS
  HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTL
  SPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV
  TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
  DDADEFGYSR
• Function: Endonuclease that mediates miRNA decay of both protein-free and AGO2-loaded miRNAs. As part of its function in miRNA decay, regulates mRNAs involved in G1-to-S phase transition. Functions as a bridging factor between STAT6 and the basal transcription factor. Plays a role in PIM1 regulation of MYB activity. Functions as a transcriptional coactivator for STAT5; (Microbial infection) Functions as a transcriptional coactivator for the Epstein-Barr virus nuclear antigen 2 (EBNA2); (Microbial infection) Promotes SARS-CoV-2 RNA synthesis by binding to negative-sense RNA and the viral protein nsp9.
• Tissue Specificity: Ubiquitously expressed.
• KEGG Pathway: Viral carcinogenesis (hsa05203)
• Reactome Pathway: Signaling by BRAF and RAF1 fusions (R-HSA-6802952)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autism	DISV4V1Z	Definitive	Biomarker	[1]
Lung cancer	DISCM4YA	Definitive	Altered Expression	[2]
Prostate cancer	DISF190Y	Definitive	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[5]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[6]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[7]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[8]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[9]
Colitis	DISAF7DD	Strong	Genetic Variation	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[12]
Epilepsy	DISBB28L	Strong	Biomarker	[1]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[16]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[17]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[2]
Lung neoplasm	DISVARNB	Strong	Biomarker	[18]
Malignant glioma	DISFXKOV	Strong	Biomarker	[19]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Altered Expression	[8]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[18]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[8]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[22]
Pneumonia	DIS8EF3M	Strong	Altered Expression	[23]
Stomach cancer	DISKIJSX	Strong	Biomarker	[13]
Small lymphocytic lymphoma	DIS30POX	moderate	Genetic Variation	[24]
Type-1 diabetes	DIS7HLUB	Disputed	Biomarker	[25]
Adult lymphoma	DISK8IZR	Limited	Genetic Variation	[26]
Anxiety	DISIJDBA	Limited	Biomarker	[27]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[27]
Breast cancer	DIS7DPX1	Limited	Biomarker	[28]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[28]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Altered Expression	[15]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[29]
Glioma	DIS5RPEH	Limited	Biomarker	[30]
Liver cancer	DISDE4BI	Limited	Altered Expression	[15]
Lymphoma	DISN6V4S	Limited	Genetic Variation	[26]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[31]
Optic neuritis	DISDYCHC	Limited	Biomarker	[32]
Pediatric lymphoma	DIS51BK2	Limited	Genetic Variation	[26]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[33]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[38]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[42]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[44]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Staphylococcal nuclease domain-containing protein 1 (SND1).	[45]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Staphylococcal nuclease domain-containing protein 1 (SND1).	[39]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Staphylococcal nuclease domain-containing protein 1 (SND1).	[43]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Staphylococcal nuclease domain-containing protein 1 (SND1).	[43]

References

• [1] Challenges in the clinical interpretation of small de novo copy number variants in neurodevelopmental disorders.Gene. 2019 Jul 20;706:162-171. doi: 10.1016/j.gene.2019.05.007. Epub 2019 May 11.
• [2] p100 functions as a metastasis activator and is targeted by tumor suppressing microRNA-320a in lung cancer.Thorac Cancer. 2018 Jan;9(1):152-158. doi: 10.1111/1759-7714.12564. Epub 2017 Nov 21.
• [3] The transcriptional co-activator SND1 is a novel regulator of alternative splicing in prostate cancer cells.Oncogene. 2014 Jul 17;33(29):3794-802. doi: 10.1038/onc.2013.360. Epub 2013 Sep 2.
• [4] Electrophysiological evidence of altered facial expressions recognition in Alzheimer's disease: A comprehensive ERP study.Clin Neurophysiol. 2019 Oct;130(10):1813-1824. doi: 10.1016/j.clinph.2019.06.229. Epub 2019 Jul 12.
• [5] Linkage and candidate gene studies of autism spectrum disorders in European populations.Eur J Hum Genet. 2010 Sep;18(9):1013-9. doi: 10.1038/ejhg.2010.69. Epub 2010 May 5.
• [6] Molecular impact of selective NFKB1 and NFKB2 signaling on DLBCL phenotype.Oncogene. 2017 Jul 20;36(29):4224-4232. doi: 10.1038/onc.2017.90. Epub 2017 Apr 3.
• [7] Systematic review of cognitive event related potentials in euthymic bipolar disorder.Clin Neurophysiol. 2018 Sep;129(9):1854-1865. doi: 10.1016/j.clinph.2018.05.025. Epub 2018 Jun 27.
• [8] SND1 promotes the proliferation of osteosarcoma cells by upregulating COX?/PGE2 expression via activation of NFB.Oncol Rep. 2019 Jan;41(1):579-589. doi: 10.3892/or.2018.6822. Epub 2018 Oct 24.
• [9] Opposing roles of Nfkb2 gene products p100 and p52 in the regulation of breast cancer stem cells. Breast Cancer Res Treat. 2017 Apr;162(3):465-477. doi: 10.1007/s10549-017-4149-0. Epub 2017 Feb 11.
• [10] Hydroalcoholic extract of Brazilian red propolis exerts protective effects on acetic acid-induced ulcerative colitis in a rodent model.Biomed Pharmacother. 2017 Jan;85:687-696. doi: 10.1016/j.biopha.2016.11.080. Epub 2016 Dec 7.
• [11] SND1 affects proliferation of hepatocellular carcinoma cell line SMMC-7721 by regulating IGFBP3 expression.Anat Rec (Hoboken). 2013 Oct;296(10):1568-75. doi: 10.1002/ar.22737. Epub 2013 Jul 22.
• [12] SND1, a component of RNA-induced silencing complex, is up-regulated in human colon cancers and implicated in early stage colon carcinogenesis.Cancer Res. 2007 Oct 1;67(19):9568-76. doi: 10.1158/0008-5472.CAN-06-2707.
• [13] MiR-361-5p inhibits colorectal and gastric cancer growth and metastasis by targeting staphylococcal nuclease domain containing-1.Oncotarget. 2015 Jul 10;6(19):17404-16. doi: 10.18632/oncotarget.3744.
• [14] The ribonuclease L-dependent antiviral roles of human 2',5'-oligoadenylate synthetase family members against hepatitis C virus.FEBS Lett. 2013 Jan 16;587(2):156-64. doi: 10.1016/j.febslet.2012.11.010. Epub 2012 Nov 26.
• [15] SND1 acts as an anti-apoptotic factor via regulating the expression of lncRNA UCA1 in hepatocellular carcinoma.RNA Biol. 2018;15(10):1364-1375. doi: 10.1080/15476286.2018.1534525. Epub 2018 Oct 25.
• [16] New Methylation Biomarker Panel for Early Diagnosis of Dysplasia or Cancer in High-Risk Inflammatory Bowel Disease Patients.Inflamm Bowel Dis. 2018 Nov 29;24(12):2555-2564. doi: 10.1093/ibd/izy255.
• [17] Common Oncogene Mutations and Novel SND1-BRAF Transcript Fusion in Lung Adenocarcinoma from Never Smokers.Sci Rep. 2015 May 18;5:9755. doi: 10.1038/srep09755.
• [18] Tudor staphylococcal nuclease drives chemoresistance of non-small cell lung carcinoma cells by regulating S100A11. Oncotarget. 2015 May 20;6(14):12156-73. doi: 10.18632/oncotarget.3495.
• [19] miR-361-5p inhibits glioma migration and invasion by targeting SND1.Onco Targets Ther. 2018 Aug 28;11:5239-5252. doi: 10.2147/OTT.S171539. eCollection 2018.
• [20] Relationship between thiol-disulphide homeostasis and visual evoked potentials in patients with multiple sclerosis.Neurol Sci. 2019 Feb;40(2):385-391. doi: 10.1007/s10072-018-3660-3. Epub 2018 Dec 1.
• [21] Identification of 28 new susceptibility loci for type 2 diabetes in the Japanese population.Nat Genet. 2019 Mar;51(3):379-386. doi: 10.1038/s41588-018-0332-4. Epub 2019 Feb 4.
• [22] The effect of marrow stromal cells on TRAF6 expression levels in myeloma cells.Oncol Lett. 2017 Aug;14(2):1464-1470. doi: 10.3892/ol.2017.6322. Epub 2017 Jun 6.
• [23] Loss of negative feedback control of nuclear factor-kappaB2 activity in lymphocytes leads to fatal lung inflammation.Am J Pathol. 2010 Jun;176(6):2646-57. doi: 10.2353/ajpath.2010.090751. Epub 2010 Apr 2.
• [24] Genetic variants in miRNA processing genes and pre-miRNAs are associated with the risk of chronic lymphocytic leukemia.PLoS One. 2015 Mar 20;10(3):e0118905. doi: 10.1371/journal.pone.0118905. eCollection 2015.
• [25] Neurophysiological Evidence for a Compensatory Activity during a Simple Oddball Task in Adolescents with Type 1 Diabetes Mellitus.J Diabetes Res. 2018 Jul 8;2018:8105407. doi: 10.1155/2018/8105407. eCollection 2018.
• [26] Transcriptional regulatory effects of lymphoma-associated NFKB2/lyt10 protooncogenes.Oncogene. 2000 Mar 2;19(10):1334-45. doi: 10.1038/sj.onc.1203432.
• [27] A Rodent Model of Anxiety: The Effect of Perinatal Immune Challenges on Gastrointestinal Inflammation and Integrity.Neuroimmunomodulation. 2018;25(3):163-175. doi: 10.1159/000493320. Epub 2018 Nov 9.
• [28] SND1 expression in breast cancer tumors is associated with poor prognosis.Ann N Y Acad Sci. 2018 Dec;1433(1):53-60. doi: 10.1111/nyas.13970. Epub 2018 Sep 14.
• [29] Genetic variants in m6A modification genes are associated with colorectal cancer risk.Carcinogenesis. 2020 Mar 13;41(1):8-17. doi: 10.1093/carcin/bgz165.
• [30] The novel chromatin architectural regulator SND1 promotes glioma proliferation and invasion and predicts the prognosis of patients.Neuro Oncol. 2019 Jun 10;21(6):742-754. doi: 10.1093/neuonc/noz038.
• [31] SND1 acts as a novel gene transcription activator recognizing the conserved Motif domains of Smad promoters, inducing TGF1 response and breast cancer metastasis.Oncogene. 2017 Jul 6;36(27):3903-3914. doi: 10.1038/onc.2017.30. Epub 2017 Mar 6.
• [32] Longitudinal optic neuritis-unrelated visual evoked potential changes in NMO spectrum disorders.Neurology. 2020 Jan 28;94(4):e407-e418. doi: 10.1212/WNL.0000000000008684. Epub 2019 Dec 3.
• [33] Pattern Visual Evoked Potential Changes in Diabetic Patients without Retinopathy.J Ophthalmol. 2017;2017:8597629. doi: 10.1155/2017/8597629. Epub 2017 Mar 14.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [40] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [41] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [44] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [45] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.