Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTE4V9S)

DOT Name Cocaine- and amphetamine-regulated transcript protein (CARTPT)
Gene Name CARTPT
Related Disease
Cerebral infarction ( )
Inflammation ( )
Multiple sclerosis ( )
Acute monocytic leukemia ( )
Acute myelogenous leukaemia ( )
Adenocarcinoma ( )
Advanced cancer ( )
Alcohol dependence ( )
Alcohol-related disorders ( )
Amyloidosis ( )
Arterial disorder ( )
Attention deficit hyperactivity disorder ( )
Carcinoid tumor ( )
Coagulation defect ( )
Craniosynostosis ( )
Drug dependence ( )
Epithelial ovarian cancer ( )
Hyperinsulinemia ( )
Hyperthyroidism ( )
Hypopharyngeal squamous cell carcinoma ( )
Intestinal neoplasm ( )
Invasive aspergillosis ( )
Late-onset Parkinson disease ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoma ( )
Major depressive disorder ( )
Mental disorder ( )
Nicotine dependence ( )
Non-insulin dependent diabetes ( )
Opioid dependence ( )
Pancytopenia ( )
Rheumatic heart disease ( )
Type-1/2 diabetes ( )
Eating disorder ( )
High blood pressure ( )
Neoplasm ( )
Neuroendocrine neoplasm ( )
Plasma cell myeloma ( )
Stroke ( )
Malaria ( )
Adult lymphoma ( )
Breast cancer ( )
Breast carcinoma ( )
Depression ( )
Gallbladder carcinoma ( )
Inherited obesity ( )
Pediatric lymphoma ( )
UniProt ID
CART_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1HY9
Pfam ID
PF06373
Sequence
MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Function
Satiety factor closely associated with the actions of leptin and neuropeptide Y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
Tissue Specificity
Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cerebral infarction DISR1WNP Definitive Biomarker [1]
Inflammation DISJUQ5T Definitive Altered Expression [2]
Multiple sclerosis DISB2WZI Definitive Altered Expression [2]
Acute monocytic leukemia DIS28NEL Strong Biomarker [3]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [3]
Adenocarcinoma DIS3IHTY Strong Biomarker [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Alcohol dependence DIS4ZSCO Strong Biomarker [6]
Alcohol-related disorders DIS3K4KK Strong Biomarker [6]
Amyloidosis DISHTAI2 Strong Biomarker [7]
Arterial disorder DISLG4XS Strong Biomarker [8]
Attention deficit hyperactivity disorder DISL8MX9 Strong Biomarker [9]
Carcinoid tumor DISMNRDC Strong Altered Expression [10]
Coagulation defect DIS9X3H6 Strong Biomarker [11]
Craniosynostosis DIS6J405 Strong Biomarker [12]
Drug dependence DIS9IXRC Strong Biomarker [13]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [14]
Hyperinsulinemia DISIDWT6 Strong Altered Expression [15]
Hyperthyroidism DISX87ZH Strong Biomarker [16]
Hypopharyngeal squamous cell carcinoma DISDDD65 Strong Biomarker [17]
Intestinal neoplasm DISK0GUH Strong Biomarker [10]
Invasive aspergillosis DISAI029 Strong Genetic Variation [18]
Late-onset Parkinson disease DIS9IOUI Strong Genetic Variation [19]
Lung cancer DISCM4YA Strong Genetic Variation [20]
Lung carcinoma DISTR26C Strong Genetic Variation [20]
Lymphoma DISN6V4S Strong Genetic Variation [21]
Major depressive disorder DIS4CL3X Strong Altered Expression [22]
Mental disorder DIS3J5R8 Strong Biomarker [23]
Nicotine dependence DISZD9W7 Strong Biomarker [24]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [25]
Opioid dependence DIS6WEHK Strong Altered Expression [26]
Pancytopenia DISVKEHV Strong Altered Expression [3]
Rheumatic heart disease DISCI8JQ Strong Genetic Variation [27]
Type-1/2 diabetes DISIUHAP Strong Biomarker [15]
Eating disorder DISVGXN0 moderate Genetic Variation [28]
High blood pressure DISY2OHH moderate Altered Expression [29]
Neoplasm DISZKGEW moderate Biomarker [4]
Neuroendocrine neoplasm DISNPLOO moderate Biomarker [30]
Plasma cell myeloma DIS0DFZ0 moderate Genetic Variation [31]
Stroke DISX6UHX moderate Biomarker [32]
Malaria DISQ9Y50 Disputed Biomarker [33]
Adult lymphoma DISK8IZR Limited Genetic Variation [21]
Breast cancer DIS7DPX1 Limited Biomarker [34]
Breast carcinoma DIS2UE88 Limited Biomarker [34]
Depression DIS3XJ69 Limited Biomarker [35]
Gallbladder carcinoma DISD6ACL Limited Genetic Variation [36]
Inherited obesity DISVH4OT Limited Autosomal dominant [37]
Pediatric lymphoma DIS51BK2 Limited Genetic Variation [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Nicotine DMWX5CO Approved Nicotine decreases the expression of Cocaine- and amphetamine-regulated transcript protein (CARTPT). [38]
Malathion DMXZ84M Approved Malathion increases the expression of Cocaine- and amphetamine-regulated transcript protein (CARTPT). [39]
Cocaine DMSOX7I Approved Cocaine increases the expression of Cocaine- and amphetamine-regulated transcript protein (CARTPT). [40]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Cocaine- and amphetamine-regulated transcript protein (CARTPT). [41]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Cocaine- and amphetamine-regulated transcript protein (CARTPT). [42]
------------------------------------------------------------------------------------

References

1 CART protects brain from damage through ERK activation in ischemic stroke.Neuropeptides. 2008 Oct-Dec;42(5-6):653-61. doi: 10.1016/j.npep.2008.05.006. Epub 2008 Jul 21.
2 Orexin A (hypocretin-1) levels are not reduced while cocaine/amphetamine regulated transcript levels are increased in the cerebrospinal fluid of patients with multiple sclerosis: no correlation with fatigue and sleepiness.J Neurol Sci. 2011 Aug 15;307(1-2):127-31. doi: 10.1016/j.jns.2011.04.024. Epub 2011 May 24.
3 Treatment of CD33-directed chimeric antigen receptor-modified T cells in one patient with relapsed and refractory acute myeloid leukemia.Mol Ther. 2015 Jan;23(1):184-91. doi: 10.1038/mt.2014.164. Epub 2014 Sep 1.
4 Changes in the Distribution of Cocaine- and Amphetamine-Regulated Transcript-Containing Neural Structures in the Human Colon Affected by the Neoplastic Process.Int J Mol Sci. 2018 Jan 31;19(2):414. doi: 10.3390/ijms19020414.
5 Distribution Patterns of Cocaine- and Amphetamine-Regulated Transcript- and/or Galanin-Containing Neurons and Nerve Fibers Located in the Human Stomach Wall Affected by Tumor.Int J Mol Sci. 2018 Oct 26;19(11):3357. doi: 10.3390/ijms19113357.
6 Reduced ethanol consumption and preference in cocaine- and amphetamine-regulated transcript (CART) knockout mice.Addict Biol. 2014 Mar;19(2):175-84. doi: 10.1111/j.1369-1600.2012.00475.x. Epub 2012 Jul 24.
7 CART treatment improves memory and synaptic structure in APP/PS1 mice.Sci Rep. 2015 May 11;5:10224. doi: 10.1038/srep10224.
8 Predictors and Outcomes of StagedVersus One-Time MultivesselRevascularization in MultivesselCoronaryArtery Disease: Insights From the VA CART Program.JACC Cardiovasc Interv. 2018 Nov 26;11(22):2265-2273. doi: 10.1016/j.jcin.2018.07.055.
9 Cocaine and amphetamine regulated transcript (CART) in suicide attempters.Psychiatry Res. 2008 Mar 15;158(2):117-22. doi: 10.1016/j.psychres.2007.06.031. Epub 2007 Dec 21.
10 Expression of cocaine- and amphetamine-regulated transcript is associated with worse survival in small bowel carcinoid tumors.Clin Cancer Res. 2012 Jul 1;18(13):3668-76. doi: 10.1158/1078-0432.CCR-11-2513. Epub 2012 May 2.
11 Coexistence Of A Huge Venous Thromboembolism And Bleeding Tendency In Cytokine Release Syndrome During CAR-T Therapy.Onco Targets Ther. 2019 Oct 30;12:8955-8960. doi: 10.2147/OTT.S223697. eCollection 2019.
12 Possible Compartmental Cytokine Release Syndrome in a Patient With Recurrent Ovarian Cancer After Treatment With Mesothelin-targeted CAR-T Cells.J Immunother. 2017 Apr;40(3):104-107. doi: 10.1097/CJI.0000000000000160.
13 Neurochemical evidence that cocaine- and amphetamine-regulated transcript (CART) 55-102 peptide modulates the dopaminergic reward system by decreasing the dopamine release in the mouse nucleus accumbens.Brain Res Bull. 2017 Sep;134:246-252. doi: 10.1016/j.brainresbull.2017.08.005. Epub 2017 Aug 9.
14 Reprogramming T-cells for adoptive immunotherapy of ovarian cancer.Expert Opin Biol Ther. 2018 Apr;18(4):359-367. doi: 10.1080/14712598.2018.1425679. Epub 2018 Jan 10.
15 Altered R-spondin 1/CART neurocircuit in the hypothalamus contributes to hyperphagia in diabetes.J Neurophysiol. 2019 Mar 1;121(3):928-939. doi: 10.1152/jn.00413.2018. Epub 2019 Jan 16.
16 Thyroid status regulates CART but not AgRP mRNA levels in the rat hypothalamus.Neuroreport. 2002 Oct 7;13(14):1775-9. doi: 10.1097/00001756-200210070-00016.
17 The functional verification of EGFR-CAR T-cells targeted to hypopharyngeal squamous cell carcinoma.Onco Targets Ther. 2018 Oct 16;11:7053-7059. doi: 10.2147/OTT.S175516. eCollection 2018.
18 Value of serial quantification of fungal DNA by a real-time PCR-based technique for early diagnosis of invasive Aspergillosis in patients with febrile neutropenia.J Clin Microbiol. 2009 Feb;47(2):379-84. doi: 10.1128/JCM.01716-08. Epub 2008 Dec 24.
19 Hypothalamic Energy Regulatory Peptides in Chronic Kidney Disease.Ther Apher Dial. 2019 Oct;23(5):437-443. doi: 10.1111/1744-9987.12798. Epub 2019 Mar 21.
20 Interactive potential of genetic polymorphism in Xenobiotic metabolising and DNA repair genes for predicting lung cancer predisposition and overall survival in North Indians.Mutat Res Genet Toxicol Environ Mutagen. 2018 Feb;826:15-24. doi: 10.1016/j.mrgentox.2017.12.006. Epub 2017 Dec 21.
21 CART cell therapy for prostate cancer: status and promise.Onco Targets Ther. 2019 Jan 3;12:391-395. doi: 10.2147/OTT.S185556. eCollection 2019.
22 Low cocaine- and amphetamine-regulated transcript (CART) peptide levels in human cerebrospinal fluid of major depressive disorder (MDD) patients.J Affect Disord. 2018 May;232:134-138. doi: 10.1016/j.jad.2018.02.039. Epub 2018 Feb 21.
23 Sex-specific differences in the dynamics of cocaine- and amphetamine-regulated transcript and nesfatin-1 expressions in the midbrain of depressed suicide victims vs. controls.Neuropharmacology. 2012 Jan;62(1):297-303. doi: 10.1016/j.neuropharm.2011.07.023. Epub 2011 Jul 22.
24 Cocaine and amphetamine regulated transcript (CART) gene in the comorbidity of schizophrenia with alcohol use disorders and nicotine dependence.Prog Neuropsychopharmacol Biol Psychiatry. 2010 Aug 16;34(6):834-6. doi: 10.1016/j.pnpbp.2010.03.030. Epub 2010 Mar 30.
25 CART is overexpressed in human type 2 diabetic islets and inhibits glucagon secretion and increases insulin secretion.Diabetologia. 2016 Sep;59(9):1928-37. doi: 10.1007/s00125-016-4020-6. Epub 2016 Jun 23.
26 Evaluation of CART peptide level in rat plasma and CSF: Possible role as a biomarker in opioid addiction.Peptides. 2016 Oct;84:1-6. doi: 10.1016/j.peptides.2016.06.010. Epub 2016 Jun 24.
27 Association study of inflammatory genes with rheumatic heart disease in North Indian population: A multi-analytical approach.Immunol Lett. 2016 Jun;174:53-62. doi: 10.1016/j.imlet.2016.04.012. Epub 2016 Apr 23.
28 The CART (cocaine- and amphetamine-regulated transcript) system in appetite and drug addiction.J Pharmacol Exp Ther. 2007 Feb;320(2):499-506. doi: 10.1124/jpet.105.091512. Epub 2006 Jul 13.
29 Central action of CART induces neuronal activation in the paraventricular and dorsomedial hypothalamus of diet-induced obese and lean mice.Neurosci Lett. 2018 Nov 1;686:175-180. doi: 10.1016/j.neulet.2018.09.015. Epub 2018 Sep 12.
30 The biochemical utility of chromogranin A, chromogranin B and cocaine- and amphetamine-regulated transcript for neuroendocrine neoplasia.Ann Clin Biochem. 2014 Jan;51(Pt 1):8-21. doi: 10.1177/0004563213489670. Epub 2013 Aug 12.
31 B cell maturation antigen-specific CAR T cells are clinically active in multiple myeloma.J Clin Invest. 2019 Mar 21;129(6):2210-2221. doi: 10.1172/JCI126397.
32 CART modulates beta-amyloid metabolism-associated enzymes and attenuates memory deficits in APP/PS1 mice.Neurol Res. 2017 Oct;39(10):885-894. doi: 10.1080/01616412.2017.1348689. Epub 2017 Jul 25.
33 Ranking malaria risk factors to guide malaria control efforts in African highlands.PLoS One. 2009 Nov 25;4(11):e8022. doi: 10.1371/journal.pone.0008022.
34 NIM: a node influence based method for cancer classification.Comput Math Methods Med. 2014;2014:826373. doi: 10.1155/2014/826373. Epub 2014 Aug 11.
35 Cocaine- and Amphetamine-Regulated Transcript (CART) Peptide Plays Critical Role in Psychostimulant-Induced Depression.Biomol Ther (Seoul). 2018 Sep 1;26(5):425-431. doi: 10.4062/biomolther.2018.141.
36 Significant role of estrogen and progesterone receptor sequence variants in gallbladder cancer predisposition: a multi-analytical strategy.PLoS One. 2012;7(7):e40162. doi: 10.1371/journal.pone.0040162. Epub 2012 Jul 10.
37 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
38 Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
39 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
40 Gene expression profile of the nucleus accumbens of human cocaine abusers: evidence for dysregulation of myelin. J Neurochem. 2004 Mar;88(5):1211-9. doi: 10.1046/j.1471-4159.2003.02247.x.
41 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
42 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.