Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVX6A59)

• DOT Name: Forkhead box protein P2 (FOXP2)
• Synonyms: CAG repeat protein 44; Trinucleotide repeat-containing gene 10 protein
• Gene Name: FOXP2
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Hyperglycemia
  Specific language disorder
  Specific language impairment
  Tuberculosis
  Adult lymphoma
  Autism spectrum disorder
  Autoimmune disease
  Bone osteosarcoma
  Cervical cancer
  Cervical carcinoma
  Childhood apraxia of speech
  Colorectal carcinoma
  Crohn disease
  Gastroesophageal reflux disease
  Hepatitis B virus infection
  Lymphoma
  Major depressive disorder
  Matthew-Wood syndrome
  Narcolepsy
  Neurodevelopmental disorder
  Non-small-cell lung cancer
  Osteosarcoma
  Pediatric lymphoma
  Pervasive developmental disorder
  Plasma cell myeloma
  Silver-Russell syndrome
  Type-1/2 diabetes
  Endometriosis
  Epilepsy
  Apraxia
  Attention deficit hyperactivity disorder
  Breast cancer
  Breast carcinoma
  Intellectual disability
  Mental disorder
  Neoplasm
  Nervous system disease
  Neuroblastoma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: FOXP2_HUMAN
• PDB ID: 2A07; 2AS5
• Pfam ID: PF00250 ; PF16159
• Sequence:
  MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
  ARQLLLQQQTSGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
  LLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
  QQQQQQQQQQQHPGKQAKEQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQG
  LISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTT
  SSNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKWPGCESICEDF
  GQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP
  KPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHS
  DKYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAY
  FRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPT
  SLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSP
  GCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
• Function: Transcriptional repressor that may play a role in the specification and differentiation of lung epithelium. May also play a role in developing neural, gastrointestinal and cardiovascular tissues. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Plays a role in synapse formation by regulating SRPX2 levels. Involved in neural mechanisms mediating the development of speech and language.
• Tissue Specificity: Isoform 1 and isoform 6 are expressed in adult and fetal brain, caudate nucleus and lung.

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Altered Expression	[1]
Hyperglycemia	DIS0BZB5	Definitive	Biomarker	[2]
Specific language disorder	DISTEUX8	Definitive	Autosomal dominant	[3]
Specific language impairment	DISEKRML	Definitive	Altered Expression	[4]
Tuberculosis	DIS2YIMD	Definitive	Altered Expression	[5]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[6]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[7]
Autoimmune disease	DISORMTM	Strong	Biomarker	[8]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[9]
Cervical cancer	DISFSHPF	Strong	Biomarker	[10]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[10]
Childhood apraxia of speech	DISIR974	Strong	Autosomal dominant	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[12]
Crohn disease	DIS2C5Q8	Strong	Genetic Variation	[13]
Gastroesophageal reflux disease	DISQ8G5S	Strong	Genetic Variation	[14]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[15]
Lymphoma	DISN6V4S	Strong	Biomarker	[6]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[16]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[17]
Narcolepsy	DISLCNLI	Strong	Genetic Variation	[18]
Neurodevelopmental disorder	DIS372XH	Strong	Biomarker	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[20]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[9]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[6]
Pervasive developmental disorder	DIS51975	Strong	Biomarker	[7]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[21]
Silver-Russell syndrome	DISSVJ1D	Strong	Biomarker	[22]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[23]
Endometriosis	DISX1AG8	moderate	Genetic Variation	[24]
Epilepsy	DISBB28L	moderate	Genetic Variation	[25]
Apraxia	DISULX63	Limited	Biomarker	[26]
Attention deficit hyperactivity disorder	DISL8MX9	Limited	Genetic Variation	[27]
Breast cancer	DIS7DPX1	Limited	Biomarker	[28]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[28]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[29]
Mental disorder	DIS3J5R8	Limited	Biomarker	[30]
Neoplasm	DISZKGEW	Limited	Biomarker	[10]
Nervous system disease	DISJ7GGT	Limited	Genetic Variation	[31]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[32]
Prostate cancer	DISF190Y	Limited	Altered Expression	[33]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[33]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Forkhead box protein P2 (FOXP2).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Forkhead box protein P2 (FOXP2).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Forkhead box protein P2 (FOXP2).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Forkhead box protein P2 (FOXP2).	[37]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Forkhead box protein P2 (FOXP2).	[38]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Forkhead box protein P2 (FOXP2).	[39]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Forkhead box protein P2 (FOXP2).	[40]
Crocin	DM5F24X	Phase 3	Crocin increases the expression of Forkhead box protein P2 (FOXP2).	[41]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Forkhead box protein P2 (FOXP2).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Forkhead box protein P2 (FOXP2).	[46]
Manganese	DMKT129	Investigative	Manganese increases the expression of Forkhead box protein P2 (FOXP2).	[48]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Forkhead box protein P2 (FOXP2).	[42]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Forkhead box protein P2 (FOXP2).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Forkhead box protein P2 (FOXP2).	[45]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Forkhead box protein P2 (FOXP2).	[47]

References

• [1] MiR-9-5p Inhibits Glioblastoma Cells Proliferation Through Directly Targeting FOXP2 (Forkhead Box P2).Front Oncol. 2019 Nov 19;9:1176. doi: 10.3389/fonc.2019.01176. eCollection 2019.
• [2] MiR-34a Regulates Axonal Growth of Dorsal Root Ganglia Neurons by Targeting FOXP2 and VAT1 in Postnatal and Adult Mouse.Mol Neurobiol. 2018 Dec;55(12):9089-9099. doi: 10.1007/s12035-018-1047-3. Epub 2018 Apr 10.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] Sociability and synapse subtype-specific defects in mice lacking SRPX2, a language-associated gene.PLoS One. 2018 Jun 19;13(6):e0199399. doi: 10.1371/journal.pone.0199399. eCollection 2018.
• [5] Predicting functional regulatory SNPs in the human antimicrobial peptide genes DEFB1 and CAMP in tuberculosis and HIV/AIDS.Comput Biol Chem. 2015 Dec;59 Pt A:117-25. doi: 10.1016/j.compbiolchem.2015.09.002. Epub 2015 Sep 9.
• [6] MicroRNA-376a regulates cell proliferation and apoptosis by targeting forkhead box protein P2 in lymphoma.Oncol Lett. 2018 Sep;16(3):3169-3176. doi: 10.3892/ol.2018.9012. Epub 2018 Jun 22.
• [7] Altered social behavior in mice carrying a cortical Foxp2 deletion.Hum Mol Genet. 2019 Mar 1;28(5):701-717. doi: 10.1093/hmg/ddy372.
• [8] Autoimmunity as a Driving Force of Cognitive Evolution.Front Neurosci. 2017 Oct 26;11:582. doi: 10.3389/fnins.2017.00582. eCollection 2017.
• [9] MicroRNA-139 inhibits the proliferation and migration of osteosarcoma cells via targeting forkhead-box P2.Life Sci. 2017 Dec 15;191:68-73. doi: 10.1016/j.lfs.2017.10.010. Epub 2017 Oct 7.
• [10] Long non-coding RNA MIR205HG function as a ceRNA to accelerate tumor growth and progression via sponging miR-122-5p in cervical cancer.Biochem Biophys Res Commun. 2019 Jun 18;514(1):78-85. doi: 10.1016/j.bbrc.2019.04.102. Epub 2019 Apr 22.
• [11] An extended family with a dominantly inherited speech disorder. Dev Med Child Neurol. 1990 Apr;32(4):352-5. doi: 10.1111/j.1469-8749.1990.tb16948.x.
• [12] MiR-9-5p suppresses cell metastasis and epithelial-mesenchymal transition through targeting FOXP2 and predicts prognosis of colorectal carcinoma.Eur Rev Med Pharmacol Sci. 2019 Aug;23(15):6467-6477. doi: 10.26355/eurrev_201908_18530.
• [13] A genome-wide association study on a southern European population identifies a new Crohn's disease susceptibility locus at RBX1-EP300.Gut. 2013 Oct;62(10):1440-5. doi: 10.1136/gutjnl-2012-302865. Epub 2012 Aug 30.
• [14] Gastroesophageal reflux GWAS identifies risk loci that also associate with subsequent severe esophageal diseases.Nat Commun. 2019 Sep 16;10(1):4219. doi: 10.1038/s41467-019-11968-2.
• [15] Expression of Foxp3 in renal tissue of patients with HBV-associated glomerulonephritis and their clinical and pathological characteristics.Exp Ther Med. 2017 Nov;14(5):4928-4934. doi: 10.3892/etm.2017.5111. Epub 2017 Sep 5.
• [16] FoxP2 is significantly associated with schizophrenia and major depression in the Chinese Han population.World J Biol Psychiatry. 2013 Mar;14(2):146-50. doi: 10.3109/15622975.2011.615860. Epub 2012 Mar 9.
• [17] miR-23a acts as an oncogene in pancreatic carcinoma by targeting FOXP2. J Investig Med. 2018 Mar;66(3):676-683.
• [18] Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
• [19] Cortical Foxp2 Supports Behavioral Flexibility and Developmental Dopamine D1 Receptor Expression.Cereb Cortex. 2020 Mar 14;30(3):1855-1870. doi: 10.1093/cercor/bhz209.
• [20] Upregulated microRNA?71?p promotes tumor progression by suppressing forkhead box P2 expression in nonsmallcell lung cancer.Mol Med Rep. 2019 Oct;20(4):3149-3159. doi: 10.3892/mmr.2019.10563. Epub 2019 Aug 6.
• [21] Aberrant expression of the neuronal transcription factor FOXP2 in neoplastic plasma cells.Br J Haematol. 2010 Apr;149(2):221-30. doi: 10.1111/j.1365-2141.2009.08070.x. Epub 2010 Jan 20.
• [22] Absence of a paternally inherited FOXP2 gene in developmental verbal dyspraxia.Am J Hum Genet. 2006 Nov;79(5):965-72. doi: 10.1086/508902. Epub 2006 Sep 27.
• [23] Genome-wide association meta-analyses and fine-mapping elucidate pathways influencing albuminuria.Nat Commun. 2019 Sep 11;10(1):4130. doi: 10.1038/s41467-019-11576-0.
• [24] Genome-wide genetic analyses highlight mitogen-activated protein kinase (MAPK) signaling in the pathogenesis of endometriosis.Hum Reprod. 2017 Apr 1;32(4):780-793. doi: 10.1093/humrep/dex024.
• [25] Aetiology of childhood apraxia of speech: A clinical practice update for paediatricians.J Paediatr Child Health. 2018 Oct;54(10):1090-1095. doi: 10.1111/jpc.14150.
• [26] Genetic Candidate Variants in Two Multigenerational Families with Childhood Apraxia of Speech.PLoS One. 2016 Apr 27;11(4):e0153864. doi: 10.1371/journal.pone.0153864. eCollection 2016.
• [27] Discovery of the first genome-wide significant risk loci for attention deficit/hyperactivity disorder.Nat Genet. 2019 Jan;51(1):63-75. doi: 10.1038/s41588-018-0269-7. Epub 2018 Nov 26.
• [28] Downregulation of FOXP2 promotes breast cancer migration and invasion through TGF/SMAD signaling pathway.Oncol Lett. 2018 Jun;15(6):8582-8588. doi: 10.3892/ol.2018.8402. Epub 2018 Mar 30.
• [29] Conserved regulation of neurodevelopmental processes and behavior by FoxP in Drosophila.PLoS One. 2019 Feb 12;14(2):e0211652. doi: 10.1371/journal.pone.0211652. eCollection 2019.
• [30] An association study of sequence variants in the forkhead box P2 (FOXP2) gene and adulthood attention-deficit/hyperactivity disorder in two European samples.Psychiatr Genet. 2012 Aug;22(4):155-60. doi: 10.1097/YPG.0b013e328353957e.
• [31] The speech and language FOXP2 gene modulates the phenotype of frontotemporal lobar degeneration.J Alzheimers Dis. 2010;22(3):923-31. doi: 10.3233/JAD-2010-101206.
• [32] Functional characterization of two enhancers located downstream FOXP2.BMC Med Genet. 2019 May 2;20(1):65. doi: 10.1186/s12881-019-0810-2.
• [33] Strong expression of the neuronal transcription factor FOXP2 is linked to an increased risk of early PSA recurrence in ERG fusion-negative cancers.J Clin Pathol. 2013 Jul;66(7):563-8. doi: 10.1136/jclinpath-2012-201335. Epub 2013 Apr 4.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [36] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [37] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [38] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [39] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [40] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [41] Crocin suppresses breast cancer cell proliferation by down-regulating tumor promoter miR-122-5p and up-regulating tumor suppressors FOXP2 and SPRY2. Environ Toxicol. 2023 Jul;38(7):1597-1608. doi: 10.1002/tox.23789. Epub 2023 Mar 29.
• [42] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [43] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [44] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [45] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [46] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [47] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [48] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.