Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ2MUJZ)

• DOT Name: Palladin (PALLD)
• Synonyms: SIH002; Sarcoma antigen NY-SAR-77
• Gene Name: PALLD
• Related Disease:
  Adenocarcinoma
  Advanced cancer
  Arteriosclerosis
  Atherosclerosis
  Beta thalassemia
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Diabetic kidney disease
  Familial adenomatous polyposis
  Familial pancreatic carcinoma
  Matthew-Wood syndrome
  Myocardial infarction
  Narcolepsy
  Neoplasm
  Nephropathy
  Non-insulin dependent diabetes
  Oculocerebrorenal syndrome
  Pancreatic cancer
  Pancreatic tumour
  Vasculitis
  Acute myelogenous leukaemia
  Coronary heart disease
  Pancreatic cancer, susceptibility to, 1
  Patent ductus arteriosus
• UniProt ID: PALLD_HUMAN
• PDB ID: 2DM2; 2DM3
• Pfam ID: PF07679
• Sequence:
  MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDS
  EKEISQIFSTSPASLCEHPSHKETKLGEHASRRPQDNRSTPVQPLAEKQTKSISSPVSKR
  KPAMSPLLTRPSYIRSLRKAEKRGAKTPSTNVKPKTPHQRKGGPQSQLCDKAANLIEELT
  SIFKAAKPRNRSPNGESSSPDSGYLSPKNQPSALLSASASQSPMEDQGEMEREVKSPGAR
  HCYQDNQDLAVPHNRKSHPQPHSALHFPAAPRFIQKLRSQEVAEGSRVYLECRVTGNPTP
  RVRWFCEGKELHNTPDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLATNPSGSDTTSAEVF
  IEGASSTDSDSESLAFKSRAGAMPQAQKKTTSVSLTIGSSSPKTGVTTAVIQPLSVPVQQ
  VHSPTSYLCRPDGTTTAYFPPVFTKELQNTAVAEGQVVVLECRVRGAPPLQVQWFRQGSE
  IQDSPDFRILQKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARNDYGSATSTAQLVVTS
  ANTENCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQ
  MQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTPAVLLSPTKEPPPLLAKPKLDPLKL
  QQLQNQIRLEQEAGARQPPPAPRSAPPSPPFPPPPAFPELAACTPPASPEPMSALASRSA
  PAMQSSGSFNYARPKQFIAAQNLGPASGHGTPASSPSSSSLPSPMSPTPRQFGRAPVPPF
  AQPFGAEPEAPWGSSSPSPPPPPPPVFSPTAAFPVPDVFPLPPPPPPLPSPGQASHCSSP
  ATRFGHSQTPAAFLSALLPSQPPPAAVNALGLPKGVTPAGFPKKASRTARIASDEEIQGT
  KDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYK
  VSSCEQRLISEIEYRLERSPVDESGDEVQYGDVPVENGMAPFFEMKLKHYKIFEGMPVTF
  TCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANP
  QGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQA
  PGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTS
  RDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGV
  PPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCT
  ARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVES
  EDL
• Function: Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization and the assembly of existing actin filaments into higher-order arrays. Binds to proteins that bind to either monomeric or filamentous actin. Localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Different isoforms may have functional differences. Involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation. Involved in targeting ACTN to specific subcellular foci.
• Tissue Specificity: Detected in both muscle and non-muscle tissues. High expression in prostate, ovary, colon, and kidney. Not detected in spleen, skeletal muscle, lung and peripheral blood lymphocytes (at protein level). Protein is overexpressed in FA6, HPAF, IMIM-PC2, SUIT-2 and PancTu-II sporadic pancreatic cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[3]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[3]
Beta thalassemia	DIS5RCQK	Strong	Genetic Variation	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Colon cancer	DISVC52G	Strong	Altered Expression	[6]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[6]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[2]
Diabetic kidney disease	DISJMWEY	Strong	Altered Expression	[7]
Familial adenomatous polyposis	DISW53RE	Strong	Genetic Variation	[8]
Familial pancreatic carcinoma	DIS1XROR	Strong	Genetic Variation	[9]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[10]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[11]
Narcolepsy	DISLCNLI	Strong	Genetic Variation	[12]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Nephropathy	DISXWP4P	Strong	Altered Expression	[13]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[14]
Oculocerebrorenal syndrome	DIS8TEDY	Strong	Biomarker	[15]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[16]
Pancreatic tumour	DIS3U0LK	Strong	Altered Expression	[1]
Vasculitis	DISQRKDX	Strong	Altered Expression	[13]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[17]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[18]
Pancreatic cancer, susceptibility to, 1	DISLC7EO	Limited	Autosomal dominant	[19]
Patent ductus arteriosus	DIS9P8YS	Limited	Biomarker	[20]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Palladin (PALLD).	[21]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Palladin (PALLD).	[22]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Palladin (PALLD).	[23]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Palladin (PALLD).	[24]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Palladin (PALLD).	[25]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Palladin (PALLD).	[26]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Palladin (PALLD).	[27]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Palladin (PALLD).	[28]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Palladin (PALLD).	[29]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Palladin (PALLD).	[30]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Palladin (PALLD).	[31]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Palladin (PALLD).	[25]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Palladin (PALLD).	[32]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Palladin (PALLD).	[28]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Palladin (PALLD).	[33]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Palladin (PALLD).	[34]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Palladin (PALLD).	[35]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Palladin (PALLD).	[36]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Palladin (PALLD).	[37]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Palladin (PALLD).	[38]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Palladin (PALLD).	[39]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Palladin (PALLD).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Palladin (PALLD).	[22]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Palladin (PALLD).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Palladin (PALLD).	[42]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Palladin (PALLD).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Palladin (PALLD).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Palladin (PALLD).	[40]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Palladin (PALLD).	[46]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Palladin (PALLD).	[27]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Palladin (PALLD).	[45]

References

• [1] Palladin expression is a conserved characteristic of the desmoplastic tumor microenvironment and contributes to altered gene expression.Cytoskeleton (Hoboken). 2015 Aug;72(8):402-11. doi: 10.1002/cm.21239. Epub 2015 Sep 3.
• [2] Twist1-induced activation of human fibroblasts promotes matrix stiffness by upregulating palladin and collagen 1(VI).Oncogene. 2016 Oct 6;35(40):5224-5236. doi: 10.1038/onc.2016.57. Epub 2016 Mar 14.
• [3] Polymorphism of the palladin gene and cardiovascular outcome in patients with atherosclerosis.Eur J Clin Invest. 2011 Apr;41(4):365-71. doi: 10.1111/j.1365-2362.2010.02416.x. Epub 2010 Nov 4.
• [4] Analysis of erythrocyte and platelet membrane proteins in various forms of beta-thalassemia.Biochemistry (Mosc). 2004 Jul;69(7):748-53. doi: 10.1023/b:biry.0000040198.62939.56.
• [5] Akt isoform-specific signaling in breast cancer: uncovering an anti-migratory role for palladin.Cell Adh Migr. 2011 May-Jun;5(3):211-4. doi: 10.4161/cam.5.3.15790. Epub 2011 May 1.
• [6] Palladin, an actin-associated protein, is required for adherens junction formation and intercellular adhesion in HCT116 colorectal cancer cells.Int J Oncol. 2010 Oct;37(4):909-26. doi: 10.3892/ijo_00000742.
• [7] The Role of Palladin in Podocytes.J Am Soc Nephrol. 2018 Jun;29(6):1662-1678. doi: 10.1681/ASN.2017091039. Epub 2018 May 2.
• [8] CDKN2A is the main susceptibility gene in Italian pancreatic cancer families.J Med Genet. 2012 Mar;49(3):164-70. doi: 10.1136/jmedgenet-2011-100281.
• [9] Absence of deleterious palladin mutations in patients with familial pancreatic cancer.Cancer Epidemiol Biomarkers Prev. 2009 Apr;18(4):1328-30. doi: 10.1158/1055-9965.EPI-09-0056. Epub 2009 Mar 31.
• [10] The role of stromal cancer-associated fibroblasts in pancreatic cancer.J Hematol Oncol. 2017 Mar 28;10(1):76. doi: 10.1186/s13045-017-0448-5.
• [11] Variations of specific non-candidate genes and risk of myocardial infarction: a replication study.Int J Cardiol. 2011 Feb 17;147(1):38-41. doi: 10.1016/j.ijcard.2009.07.028. Epub 2009 Aug 25.
• [12] Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
• [13] Palladin is upregulated in kidney disease and contributes to epithelial cell migration after injury.Sci Rep. 2015 Jan 9;5:7695. doi: 10.1038/srep07695.
• [14] Genetic analysis of advanced glycation end products in the DHS MIND study.Gene. 2016 Jun 15;584(2):173-9. doi: 10.1016/j.gene.2016.02.029. Epub 2016 Feb 23.
• [15] PALLD Regulates Phagocytosis by Enabling Timely Actin Polymerization and Depolymerization.J Immunol. 2017 Sep 1;199(5):1817-1826. doi: 10.4049/jimmunol.1602018. Epub 2017 Jul 24.
• [16] Screening of high-risk families for pancreatic cancer.Pancreatology. 2009;9(3):215-22. doi: 10.1159/000210262. Epub 2009 Apr 7.
• [17] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [18] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [19] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [20] Isoform-specific upregulation of palladin in human and murine pancreas tumors.PLoS One. 2010 Apr 26;5(4):e10347. doi: 10.1371/journal.pone.0010347.
• [21] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [22] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [23] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [24] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [25] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [26] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [27] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [28] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [29] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [30] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [31] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [32] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [33] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [34] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [35] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [36] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [37] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [38] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [39] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [40] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [41] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [44] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [45] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [46] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.