Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTFI42L)

• DTP Name: Multidrug resistance-associated protein 2 (ABCC2)
• Gene Name: ABCC2
• UniProt ID: Q92887 (MRP2_HUMAN)
• VARIDT ID: DTD0002
• Synonyms: ABC30; ABCC2; ATP-binding cassette sub-family C member 2; CMOAT; CMOAT1; CMRP; Canalicular multidrug resistance protein; Canalicular multispecific organic anion transporter 1; DJS; MRP2
• DTP Family:
  ATP-Binding Cassette (ABC) Superfamily
  Drug Conjugate Transporter (DCT) Family (ABCC)
• Tissue Specificity: Expression in the hepatocytes, renal proximal tubule cells, and intestinal epithelia, and expression in the gallbladder, bronchi, and placenta, It is, however, present in brain capillaries of hippocampus specimens from patients with temporal lobe epilepsy, and in malignant tumor cells from renal clear-cell, hepatocellular, ovarian, colorectal, lung, breast, and gastric carcinomas
• Sequence:
  MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSS
  TTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYS
  RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILI
  FSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVS
  KFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSG
  TKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIG
  YLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGET
  VNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAIL
  STKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFS
  QLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMI
  SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD
  IMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
  FGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
  IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIV
  EKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAAS
  ITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETG
  KVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQR
  DMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRI
  VNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMF
  YVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSW
  ITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTS
  EIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGI
  TCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTII
  PQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIG
  QRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMD
  SDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF
• Function: This transporter mediates hepatobiliary excretion of numerous organic anions and may function as a cellular cisplatin transporter.
• Endogenous Substrate(s): Alkaloids; Bilirubin glucuronides; Cysteinyl leukotrienes; E2 17 beta glucuronide; Epipodophyllotosine; Glutahione conjugates; Glutathione dilsulfide; Hepatic canalicular conjugates; Reduced glutathione; Taruochenodeoxycholate sulfate; Taurolithocholate sulfate; Dehydroepiandrosterone sulfate
• TCDB ID: 3.A.1.208.2
• Gene ID: 1244
• KEGG Pathway:
  Antifolate resistance (hsa01523)
  Platinum drug resistance (hsa01524)
  ABC transporters (hsa02010)
  Bile secretion (hsa04976)
• Reactome Pathway:
  ABC-family proteins mediated transport (R-HSA-382556)
  Defective ABCC2 causes DJS (R-HSA-5679001)
  Aspirin ADME (R-HSA-9749641)
  Paracetamol ADME (R-HSA-9753281)
  Atorvastatin ADME (R-HSA-9754706)
  Heme degradation (R-HSA-189483)

Molecular Interaction Atlas (MIA) of This DTP

75 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetaminophen	DMUIE76	Pain	MG30-MG3Z	Approved	[1]
Aciclovir	DMYLOVR	Virus infection	1A24-1D9Z	Approved	[2]
Adefovir	DMM278X	Hepatitis B virus infection	1E51.0	Approved	[3]
Ampicillin	DMHWE7P	Bacterial infection	1A00-1C4Z	Approved	[4]
Arsenic trioxide	DM61TA4	Acute lymphoblastic leukaemia	2A85	Approved	[5]
Carbamazepine	DMZOLBI	Epilepsy	8A60-8A68	Approved	[6]
Cefadroxil	DMMC345	Bacterial infection	1A00-1C4Z	Approved	[7]
Cefodizime	DMORSGU	Bacterial infection	1A00-1C4Z	Approved	[4]
Ceftriaxone	DMCEW64	Bacterial infection	1A00-1C4Z	Approved	[4]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[8]
Cholic acid	DM7OKQV	Peroxisomal disorder	5C57	Approved	[9]
Ciclosporin	DMT2KRV	Psoriasis vulgaris	EA90	Approved	[10]
Cidofovir	DMA13GD	Cytomegalovirus infection	1D82	Approved	[4]
Cisplatin	DMRHGI9	Solid tumour/cancer	2A00-2F9Z	Approved	[11]
Dehydroepiandrosterone sulfate	DM4Q80H	Dyspareunia	GA12	Approved	[12]
Dinoprostone	DMTYOPD	Medical abortion	JA00.1Z	Approved	[13]
Docetaxel	DMDI269	Solid tumour/cancer	2A00-2F9Z	Approved	[14]
Doxorubicin	DMVP5YE	Solid tumour/cancer	2A00-2F9Z	Approved	[15]
Enalapril	DMNFUZR	Hypertension	BA00-BA04	Approved	[16]
Epirubicin	DMPDW6T	Solid tumour/cancer	2A00-2F9Z	Approved	[4]
Erythromycin	DM4K7GQ	Bacterial infection	1A00-1C4Z	Approved	[17]
Estrone sulfate	DMVBIZL	Menopausal and postmenopausal disorder	GA30	Approved	[18]
Etoposide	DMNH3PG	Solid tumour/cancer	2A00-2F9Z	Approved	[19]
Ezetimibe	DM7A8TW	Hypercholesterolaemia	5C80.0	Approved	[20]
Fluorescein	DMQTFAO	Ocular disease	1F00.1Z	Approved	[21]
Fluorouracil	DMUM7HZ	Solid tumour/cancer	2A00-2F9Z	Approved	[22]
Folic acid	DMEMBJC	Folate-deficiency anemia	3A02.Y	Approved	[23]
Gadobenate dimeglumine	DM4VAOG	Schizophrenia	6A20	Approved	[24]
Gatifloxacin	DMSL679	Respiratory tract infection	CA45	Approved	[25]
Gemifloxacin	DMHT34O	Bacterial infection	1A00-1C4Z	Approved	[26]
Glutathione	DMAHMT9	Human immunodeficiency virus infection	1C62	Approved	[27]
Grepafloxacin	DMGLX0T	Chronic bronchitis	CA20.1	Approved	[28]
Indinavir	DM0T3YH	Human immunodeficiency virus infection	1C62	Approved	[29]
Irinotecan	DMP6SC2	Colorectal cancer	2B91.Z	Approved	[30]
Leucovorin	DMUAZWG	Colorectal cancer	2B91.Z	Approved	[31]
Lopinavir	DMITQS0	Human immunodeficiency virus infection	1C62	Approved	[32]
Mesalazine	DMOL5IU	Ulcerative colitis	DD71	Approved	[33]
Methotrexate	DM2TEOL	leukaemia	2A60-2B33	Approved	[34]
Mitoxantrone	DMM39BF	Solid tumour/cancer	2A00-2F9Z	Approved	[4]
Mycophenolate mofetil	DMPQAGE	Organ transplant rejection	NE84	Approved	[35]
Mycophenolic acid	DMYTN18	Organ transplant rejection	NE84	Approved	[36]
Nilotinib	DM7HXWT	Chronic myelogenous leukaemia	2A20.0	Approved	[37]
Octreotide	DMHIDCJ	Acromegaly	5A60.0	Approved	[38]
Olamufloxacin	DMQ4PKA	Bacterial infection	1A00-1C4Z	Approved	[39]
Olmesartan medoxomil	DMWBHRY	High blood pressure	BA00	Approved	[40]
Oxaliplatin	DMQNWRD	Colorectal cancer	2B91.Z	Approved	[41]
Paclitaxel	DMLB81S	Breast cancer	2C60-2C65	Approved	[42]
Pemetrexed	DMMX2E6	Malignant pleural mesothelioma	2C26.0	Approved	[39]
Pemirolast	DML97WV	Allergic conjunctivitis	9A60.02	Approved	[39]
Phenobarbital	DMXZOCG	Seizure disorder	8A6Z	Approved	[43]
Phenytoin	DMNOKBV	Epilepsy	8A60-8A68	Approved	[44]
Pitavastatin	DMJH792	Hyperlipidemia	5C80.Z	Approved	[45]
Pitavastatin calcium	DM1UJO0	Dyslipidemia	5C80-5C81	Approved	[4]
Pravastatin	DM6A0X7	Hypercholesterolaemia	5C80.0	Approved	[46]
Probenecid	DMMFWOJ	Gout	FA25	Approved	[47]
Raltitrexed	DMT9K8G	Rectal adenocarcinoma	2B92	Approved	[48]
Regorafenib	DMHSY1I	Metastatic colorectal cancer	2B91	Approved	[49]
Rifampin	DMA8J1G	Tuberculosis	1B10-1B1Z	Approved	[50]
Ritonavir	DMU764S	Human immunodeficiency virus infection	1C62	Approved	[29]
Rosuvastatin	DMMIQ7G	Hypercholesterolaemia	5C80.0	Approved	[51]
Saquinavir	DMG814N	Human immunodeficiency virus infection	1C62	Approved	[52]
Sorafenib	DMS8IFC	Hepatocellular carcinoma	2C12.02	Approved	[53]
Succimer	DME81IY	Metal intoxication	NE60	Approved	[54]
Sulfasalazine	DMICA9H	Irritable bowel syndrome	DD91.0	Approved	[55]
Sulfinpyrazone	DMEV954	Gout	FA25	Approved	[56]
Technetium (99MTC) mebrofenin	DMUEWM3	Diagnostic imaging	N.A.	Approved	[4]
Telithromycin	DMZ4P3A	Bacterial infection	1A00-1C4Z	Approved	[15]
Temocaprilate	DMNX2QI	High blood pressure	BA00	Approved	[4]
Temocaprilate	DMNX2QI	High blood pressure	BA00	Approved	[3]
Valproate	DMCFE9I	Epilepsy	8A60-8A68	Approved	[3]
Valsartan	DMREUQ6	Hypertension	BA00-BA04	Approved	[57]
Vasopressin	DMQ2FPC	Diabetes insipidus	5A61.5	Approved	[58]
Vinblastine	DM5TVS3	Solid tumour/cancer	2A00-2F9Z	Approved	[59]
Vincristine	DMINOX3	Acute lymphoblastic leukaemia	2A85	Approved	[4]
VRX496	DMIO4V5	Acquired immune deficiency syndrome	1C62.3	Approved	[4]

9 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Camptothecin	DM6CHNJ	Solid tumour/cancer	2A00-2F9Z	Phase 3	[3]
Glycyrrhizin	DM8M2N3	Influenza virus infection	1E30-1E32	Phase 3	[39]
BQ-123	DM0MO8I	Pulmonary arterial hypertension	BB01.0	Phase 2	[39]
CKD602	DMW9F1G	Solid tumour/cancer	2A00-2F9Z	Phase 2	[39]
Glutathione-S-S-glutathione	DMJ85FS	Ovarian cancer	2C73	Phase 2	[60]
LE-SN38	DMW50NF	Colorectal cancer	2B91.Z	Phase 2	[61]
PEITC	DMOMN31	Prostate cancer	2C82.0	Phase 2	[62]
Epicatechin	DMN0EMP	Duchenne dystrophy	8C70	Phase 1/2	[63]
Sodium taurocholate	DM3GO0J	Type-2 diabetes	5A11	Phase 1/2	[64]

3 Discontinued Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Phenolphthalein	DM5SICT	Constipation	DD91.1	Withdrawn from market	[65]
Azithromycin/chloroquine	DM7G8T0	Bacterial infection	1A00-1C4Z	Discontinued in Phase 3	[66]
Rhodamine-123	DMQAK6T	Prostate cancer	2C82.0	Discontinued in Phase 1	[67]

3 Preclinical Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alpha-Zearalenol	DMQMAWK	Cardiovascular disease	BA00-BE2Z	Preclinical	[68]
Scutellarin	DMJT1E5	Cerebrovascular ischaemia	8B1Z	Preclinical	[69]
Taxifolin	DMQJSF9	Ovarian cancer	2C73	Preclinical	[70]

11 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aminohippuric acid	DMUN54G	Discovery agent	N.A.	Investigative	[71]
Bilirubin	DMI0V4O	Discovery agent	N.A.	Investigative	[72]
CCK-8	DMN0J4W	N. A.	N. A.	Investigative	[18]
Chelerythrine	DMCP1G9	Discovery agent	N.A.	Investigative	[39]
Genistein-7-glucoside	DMMLNTW	Solid tumour/cancer	2A00-2F9Z	Investigative	[4]
Glycocholic acid	DM0SXNM	Discovery agent	N.A.	Investigative	[73]
N5-methylfolate	DML0R9M	Discovery agent	N.A.	Investigative	[39]
Phlorizin	DMNARGO	Discovery agent	N.A.	Investigative	[4]
Talinolol	DMRTD16	Discovery agent	N.A.	Investigative	[74]
Tauroursodeoxycholic acid	DMFKRQE	Discovery agent	N.A.	Investigative	[75]
[3H]estradiol-17beta-glucuronide	DM3KJ45	Discovery agent	N.A.	Investigative	[76]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.29E-14	-3.25E-01	-7.49E-01
Adrenocortical carcinoma	2D11.Z	Kidney	6.05E-01	-6.69E-02	-1.18E-01
Alopecia	ED70	Skin from scalp	4.03E-01	3.49E-02	1.11E-01
Alzheimer's disease	8A20	Entorhinal cortex	7.16E-01	-1.28E-02	-6.06E-02
Ankylosing spondylitis	FA92.0	Pheripheral blood	2.49E-01	1.29E-01	7.94E-01
Aortic stenosis	BB70	Calcified aortic valve	8.86E-01	7.20E-03	1.84E-02
Apnea	7A40	Hyperplastic tonsil	3.64E-01	9.84E-02	6.62E-01
Arthropathy	FA00-FA5Z	Peripheral blood	3.63E-01	4.16E-02	2.24E-01
Asthma	CA23	Nasal and bronchial airway	7.82E-01	2.14E-03	4.38E-03
Atopic dermatitis	EA80	Skin	2.52E-01	1.05E-02	8.67E-02
Autism	6A02	Whole blood	8.54E-01	-3.99E-02	-1.31E-01
Autoimmune uveitis	9A96	Peripheral monocyte	4.81E-01	4.69E-02	2.89E-01
Autosomal dominant monocytopenia	4B04	Whole blood	2.05E-01	4.07E-01	1.62E+00
Bacterial infection of gingival	1C1H	Gingival tissue	6.91E-01	6.87E-03	3.05E-02
Batten disease	5C56.1	Whole blood	7.00E-01	1.86E-01	1.07E+00
Behcet's disease	4A62	Peripheral blood	3.08E-01	7.35E-02	3.54E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	8.63E-01	9.14E-03	5.41E-02
Bladder cancer	2C94	Bladder tissue	9.44E-01	-1.80E-01	-5.06E-01
Breast cancer	2C60-2C6Z	Breast tissue	2.95E-07	-2.11E-01	-4.00E-01
Cardioembolic stroke	8B11.20	Whole blood	2.54E-06	6.44E-01	1.49E+00
Cervical cancer	2C77	Cervical tissue	7.81E-01	3.85E-02	1.27E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	4.19E-01	-8.92E-02	-1.73E-01
Chronic hepatitis C	1E51.1	Whole blood	7.73E-01	-2.06E-02	-1.29E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	3.49E-01	6.59E-02	3.03E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	3.57E-01	-8.50E-02	-2.09E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	2.19E-01	0.00E+00	0.00E+00
Colon cancer	2B90	Colon tissue	1.42E-20	2.40E-01	5.69E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	2.45E-01	-3.27E-01	-1.24E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	3.39E-01	-9.43E-02	-1.75E-01
Endometriosis	GA10	Endometrium tissue	6.57E-01	-7.03E-03	-3.29E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	8.01E-01	-9.49E-02	-6.06E-01
Familial hypercholesterolemia	5C80.00	Whole blood	4.30E-02	-2.29E-01	-9.10E-01
Gastric cancer	2B72	Gastric tissue	4.48E-02	1.85E-01	9.45E-01
Glioblastopma	2A00.00	Nervous tissue	6.76E-01	2.25E-02	7.43E-02
Glioma	2A00.0Y-2A00.0Z	White matter tissue	2.04E-01	-1.77E-01	-5.42E-01
Head and neck cancer	2D42	Head and neck tissue	5.32E-02	-1.36E-01	-2.97E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	1.17E-02	-1.29E-01	-4.98E-01
Huntington's disease	8A01.10	Whole blood	1.38E-01	6.18E-02	4.19E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	1.80E-01	-1.17E-01	-7.13E-01
Immunodeficiency	4A00-4A20	Peripheral blood	5.49E-01	-2.68E-02	-2.25E-01
Influenza	1.00E+30	Whole blood	5.14E-01	1.28E-01	4.45E-01
Interstitial cystitis	GC00.3	Bladder tissue	6.75E-01	-2.47E-03	-9.45E-03
Intracranial aneurysm	8B01.0	Intracranial artery	1.25E-03	-3.79E-01	-9.14E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	5.23E-01	8.97E-03	3.36E-02
Ischemic stroke	8B11	Peripheral blood	6.64E-01	-1.38E-02	-9.45E-02
Juvenile idiopathic arthritis	FA24	Peripheral blood	1.46E-02	-1.88E-01	-3.83E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	8.87E-01	1.81E-01	6.06E-01
Lateral sclerosis	8B60.4	Skin	9.30E-01	2.49E-03	1.31E-02
Liver cancer	2C12.0	Liver tissue	3.26E-02	2.25E-02	3.48E-02
Liver failure	DB99.7-DB99.8	Liver tissue	1.45E-02	-1.98E+00	-3.61E+00
Lung cancer	2C25	Lung tissue	1.02E-08	-5.12E-02	-2.22E-01
Lupus erythematosus	4A40	Whole blood	7.36E-09	3.25E-01	6.71E-01
Major depressive disorder	6A70-6A7Z	Whole blood	5.42E-02	1.01E-01	2.09E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	1.85E-02	5.14E-02	3.36E-01
Melanoma	2C30	Skin	3.60E-03	5.12E-02	6.03E-02
Multiple myeloma	2A83.1	Bone marrow	2.22E-01	-1.68E-01	-6.27E-01
Multiple myeloma	2A83.1	Peripheral blood	2.44E-01	6.35E-02	3.90E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	4.24E-01	2.07E-01	6.55E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	8.42E-01	6.53E-04	5.72E-03
Myelofibrosis	2A20.2	Whole blood	5.87E-01	-2.27E-02	-1.39E-01
Myocardial infarction	BA41-BA50	Peripheral blood	6.93E-01	9.50E-02	1.25E-01
Myopathy	8C70.6	Muscle tissue	1.38E-01	-1.42E-01	-8.33E-01
Neonatal sepsis	KA60	Whole blood	2.04E-05	1.82E-01	6.30E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	7.79E-04	-8.57E-01	-1.99E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	8.73E-01	3.60E-02	8.80E-02
Obesity related type 2 diabetes	5A11	Omental adipose tissue	1.94E-01	3.14E-01	2.46E+00
Olive pollen allergy	CA08.00	Peripheral blood	1.05E-01	-2.11E-01	-1.36E+00
Oral cancer	2B6E	Oral tissue	2.89E-03	-2.40E-01	-9.52E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	5.68E-01	5.84E-03	1.64E-02
Osteoporosis	FB83.1	Bone marrow	6.56E-01	6.43E-02	2.99E-01
Ovarian cancer	2C73	Ovarian tissue	9.91E-01	-4.05E-02	-1.15E-01
Pancreatic cancer	2C10	Pancreas	2.85E-01	-3.85E-01	-9.20E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	6.25E-01	8.95E-02	8.58E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	2.15E-01	8.74E-02	5.78E-01
Pituitary cancer	2D12	Pituitary tissue	1.96E-01	-8.30E-03	-2.10E-02
Pituitary gonadotrope tumour	2D12	Pituitary tissue	2.15E-01	-8.70E-02	-2.24E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	4.68E-01	5.75E-02	3.48E-01
Polycythemia vera	2A20.4	Whole blood	5.58E-03	9.73E-02	5.83E-01
Pompe disease	5C51.3	Biceps muscle	7.81E-01	-8.15E-02	-4.87E-01
Preterm birth	KA21.4Z	Myometrium	5.00E-01	-1.74E-02	-1.81E-01
Prostate cancer	2C82	Prostate	1.58E-01	-4.23E-01	-7.28E-01
Psoriasis	EA90	Skin	7.41E-21	4.03E-01	1.33E+00
Rectal cancer	2B92	Rectal colon tissue	2.34E-03	4.75E-01	1.43E+00
Renal cancer	2C90-2C91	Kidney	5.05E-01	-2.11E-01	-2.62E-01
Retinoblastoma	2D02.2	Uvea	8.84E-02	-7.19E-01	-1.41E+00
Rheumatoid arthritis	FA20	Synovial tissue	5.30E-02	3.89E-01	7.37E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	4.20E-01	-4.75E-02	-1.92E-01
Schizophrenia	6A20	Prefrontal cortex	8.96E-02	1.20E-01	3.25E-01
Schizophrenia	6A20	Superior temporal cortex	8.44E-01	1.30E-02	1.07E-01
Scleroderma	4A42.Z	Whole blood	7.59E-01	5.11E-02	1.98E-01
Seizure	8A60-8A6Z	Whole blood	8.88E-01	4.47E-02	1.88E-01
Sensitive skin	EK0Z	Skin	9.43E-01	6.45E-02	3.37E-01
Sepsis with septic shock	1G41	Whole blood	2.71E-24	2.63E-01	7.81E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	4.53E-01	4.05E-01	1.36E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	4.40E-02	1.38E-01	6.50E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	7.16E-01	1.73E-01	1.25E+00
Sjogren's syndrome	4A43.2	Salivary gland tissue	7.84E-01	8.30E-03	2.75E-01
Skin cancer	2C30-2C3Z	Skin	7.78E-17	2.20E-01	4.83E-01
Thrombocythemia	3B63	Whole blood	6.94E-03	8.23E-02	4.95E-01
Thrombocytopenia	3B64	Whole blood	3.99E-01	1.71E-01	3.53E-01
Thyroid cancer	2D10	Thyroid	1.52E-01	3.61E-02	1.60E-01
Tibial muscular dystrophy	8C75	Muscle tissue	1.49E-06	-6.14E-01	-2.68E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	7.68E-01	5.74E-02	5.34E-01
Type 2 diabetes	5A11	Liver tissue	7.65E-01	-2.63E-02	-1.32E-01
Ureter cancer	2C92	Urothelium	1.26E-01	-1.20E-01	-5.95E-01
Uterine cancer	2C78	Endometrium tissue	1.96E-01	3.38E-02	1.08E-01
Vitiligo	ED63.0	Skin	1.33E-02	-3.60E-01	-1.43E+00

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Etoposide	Approved	Madin-Darby canine kidney cells (MDCKII)-MRP2	Km = 617 microM	[19]
Irinotecan	Approved	Bile canalicular membrane vesicles-MRP2	Km = 48.9 microM	[61]
Irinotecan	Approved	Madin-Darby canine kidney cells (MDCKII)-MRP2	Km = 90.8 microM	[30]
Methotrexate	Approved	Human embryonic kidney cells (HEK293)-MRP2	Km = 480 microM	[77]
Olmesartan medoxomil	Approved	LLC-PK1 cells-MRP2	Km = 14.9 microM	[40]
Valsartan	Approved	LLC-PK1 cells-MRP2	Km = 30.4 microM	[57]
Vinblastine	Approved	Madin-Darby canine kidney cells (MDCKII)-MRP2	Km = 137.3 microM	[78]

Clinical Trial Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
LE-SN38	Phase 2	Bile canalicular membrane vesicles-MRP2	Km = 180 microM	[61]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Aminohippuric acid	Investigative	Human embryonic kidney cells (HEK293)-MRP2	Km = 880 microM	[71]
Aminohippuric acid	Investigative	Madin-Darby canine kidney cells (MDCKII)-MRP2	Km = 2100 microM	[79]
Aminohippuric acid	Investigative	Spodoptera frugiperda (Sf9) cells-MRP2	Km = 5000 microM	[79]
Bilirubin	Investigative	Human embryonic kidney cells (HEK293)-MRP2	Km = 0.7 microM	[72]
Bilirubin	Investigative	Human embryonic kidney cells (HEK293)-MRP2	Km = 0.9 microM	[72]
[3H]estradiol-17beta-glucuronide	Investigative	Human embryonic kidney cells (HEK293)-MRP2	Km = 7.2 microM	[76]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Multidrug resistance-associated protein 2 (ABCC2) DTT Info
• DTP DTT Type: Literature-reported

References

• [1] Effect of acetaminophen on expression and activity of rat liver multidrug resistance-associated protein 2 and P-glycoprotein. Biochem Pharmacol. 2004 Aug 15;68(4):791-8.
• [2] Gene expression in the human intestine and correlation with oral valacyclovir pharmacokinetic parameters. J Pharmacol Exp Ther. 2003 Aug;306(2):778-86.
• [3] Pharmacogenetics of membrane transporters: an update on current approaches. Mol Biotechnol. 2010 Feb;44(2):152-67.
• [4] Mammalian drug efflux transporters of the ATP binding cassette (ABC) family in multidrug resistance: A review of the past decade. Cancer Lett. 2016 Jan 1;370(1):153-64.
• [5] MRP2 and acquired tolerance to inorganic arsenic in the kidney of killifish (Fundulus heteroclitus). Toxicol Sci. 2007 May;97(1):103-10.
• [6] A nonsynonymous variation in MRP2/ABCC2 is associated with neurological adverse drug reactions of carbamazepine in patients with epilepsy. Pharmacogenet Genomics. 2010 Apr;20(4):249-56.
• [7] Oral availability of cefadroxil depends on ABCC3 and ABCC4. Drug Metab Dispos. 2012 Mar;40(3):515-21.
• [8] Identification of the hepatic efflux transporters of organic anions using double-transfected Madin-Darby canine kidney II cells expressing human organic anion-transporting polypeptide 1B1 (OATP1B1)/multidrug resistance-associated protein 2, OATP1B1/multidrug resistance 1, and OATP1B1/breast cancer resistance protein. J Pharmacol Exp Ther. 2005 Sep;314(3):1059-67.
• [9] Multiple pathways for fluoroquinolone secretion by human intestinal epithelial (Caco-2) cells. Br J Pharmacol. 2002 Mar;135(5):1263-75.
• [10] Is cyclosporine A transport inhibited by pravastatin via multidrug resistant protein 2? Eur J Clin Pharmacol. 2010 Feb;66(2):153-8.
• [11] Lentivirus-mediated RNAi silencing targeting ABCC2 increasing the sensitivity of a human nasopharyngeal carcinoma cell line against cisplatin. J Transl Med. 2008 Oct 4;6:55.
• [12] Directional trans-epithelial transport of organic anions in porcine LLC-PK1 cells that co-express human OATP1B1 (OATP-C) and MRP2. Biochem Pharmacol. 2005 Feb 1;69(3):415-23.
• [13] Multidrug resistance associated protein 2 mediates transport of prostaglandin E2. Liver Int. 2006 Apr;26(3):362-8.
• [14] Transport of diclofenac by breast cancer resistance protein (ABCG2) and stimulation of multidrug resistance protein 2 (ABCC2)-mediated drug transport by diclofenac and benzbromarone. Drug Metab Dispos. 2009 Jan;37(1):129-36.
• [15] Involvement of the drug transporters p glycoprotein and multidrug resistance-associated protein Mrp2 in telithromycin transport. Antimicrob Agents Chemother. 2006 Jan;50(1):80-7.
• [16] Vectorial transport of enalapril by Oatp1a1/Mrp2 and OATP1B1 and OATP1B3/MRP2 in rat and human livers. J Pharmacol Exp Ther. 2006 Jul;318(1):395-402.
• [17] Effect of ABCC2 (MRP2) transport function on erythromycin metabolism. Clin Pharmacol Ther. 2011 May;89(5):693-701.
• [18] Human hepatobiliary transport of organic anions analyzed by quadruple-transfected cells. Mol Pharmacol. 2005 Oct;68(4):1031-8.
• [19] Delineating the contribution of secretory transporters in the efflux of etoposide using Madin-Darby canine kidney (MDCK) cells overexpressing P-glycoprotein (Pgp), multidrug resistance-associated protein (MRP1), and canalicular multispecific organic anion transporter (cMOAT). Drug Metab Dispos. 2002 Apr;30(4):457-63.
• [20] Intestinal expression of P-glycoprotein (ABCB1), multidrug resistance associated protein 2 (ABCC2), and uridine diphosphate-glucuronosyltransferase 1A1 predicts the disposition and modulates the effects of the cholesterol absorption inhibitor ezetimibe in humans. Clin Pharmacol Ther. 2006 Mar;79(3):206-17.
• [21] Phosphoinositide 3-kinase/protein kinase B signaling pathway is involved in estradiol 17-D-glucuronide-induced cholestasis: complementarity with classical protein kinase C. Hepatology. 2010 Oct;52(4):1465-76.
• [22] Enhancing chemosensitivity in oral squamous cell carcinoma by lentivirus vector-mediated RNA interference targeting EGFR and MRP2. Oncol Lett. 2016 Sep;12(3):2107-2114.
• [23] Mammalian multidrug-resistance proteins (MRPs). Essays Biochem. 2011 Sep 7;50(1):179-207.
• [24] Liver Perfusion Modifies Gd-DTPA and Gd-BOPTA Hepatocyte Concentrations Through Transfer Clearances Across Sinusoidal Membranes. Eur J Drug Metab Pharmacokinet. 2017 Aug;42(4):657-667.
• [25] Uptake and intracellular release kinetics of liposome formulations in glioma cells. Int J Pharm. 2010 Aug 16;395(1-2):251-9.
• [26] Differential effect of P-gp and MRP2 on cellular translocation of gemifloxacin. Int J Pharm. 2011 Nov 25;420(1):26-33.
• [27] Oxidative and electrophilic stress induces multidrug resistance-associated protein transporters via the nuclear factor-E2-related factor-2 transcriptional pathway. Hepatology. 2007 Nov;46(5):1597-610.
• [28] Fluoroquinolone efflux mediated by ABC transporters. J Pharm Sci. 2008 Sep;97(9):3483-93.
• [29] Interaction of eight HIV protease inhibitors with the canalicular efflux transporter ABCC2 (MRP2) in sandwich-cultured rat and human hepatocytes. Biopharm Drug Dispos. 2010 Mar;31(2-3):178-88.
• [30] Intestinal transport of irinotecan in Caco-2 cells and MDCK II cells overexpressing efflux transporters Pgp, cMOAT, and MRP1. Drug Metab Dispos. 2002 Jul;30(7):763-70.
• [31] Transport of methotrexate, methotrexate polyglutamates, and 17beta-estradiol 17-(beta-D-glucuronide) by ABCG2: effects of acquired mutations at R482 on methotrexate transport. Cancer Res. 2003 Jul 15;63(14):4048-54.
• [32] Effects of cytochrome P450 3A (CYP3A) and the drug transporters P-glycoprotein (MDR1/ABCB1) and MRP2 (ABCC2) on the pharmacokinetics of lopinavir. Br J Pharmacol. 2010 Jul;160(5):1224-33.
• [33] Transport studies with 5-aminosalicylate. Eur J Clin Pharmacol. 2006 Oct;62(10):871-5.
• [34] Dose-dependent disposition of methotrexate in Abcc2 and Abcc3 gene knockout murine models. Drug Metab Dispos. 2011 Nov;39(11):2155-61.
• [35] Influence of SLCO1B1, 1B3, 2B1 and ABCC2 genetic polymorphisms on mycophenolic acid pharmacokinetics in Japanese renal transplant recipients. Eur J Clin Pharmacol. 2007 Dec;63(12):1161-9.
• [36] C-440T/T-331C polymorphisms in the UGT1A9 gene affect the pharmacokinetics of mycophenolic acid in kidney transplantation. Pharmacogenomics. 2007 Sep;8(9):1127-41.
• [37] Interaction of nilotinib, dasatinib and bosutinib with ABCB1 and ABCG2: implications for altered anti-cancer effects and pharmacological properties. Br J Pharmacol. 2009 Oct;158(4):1153-64.
• [38] P-glycoprotein- and mrp2-mediated octreotide transport in renal proximal tubule. Br J Pharmacol. 2000 Jan;129(2):251-6.
• [39] Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
• [40] Multiple human isoforms of drug transporters contribute to the hepatic and renal transport of olmesartan, a selective antagonist of the angiotensin II AT1-receptor. Drug Metab Dispos. 2007 Dec;35(12):2166-76.
• [41] Multidrug Resistance-Associated Protein 2 (MRP2) Mediated Transport of Oxaliplatin-Derived Platinum in Membrane Vesicles. PLoS One. 2015 Jul 1;10(7):e0130727.
• [42] Multidrug resistance protein 2 is an important determinant of paclitaxel pharmacokinetics. Clin Cancer Res. 2006 Oct 15;12(20 Pt 1):6125-32.
• [43] Regulation of multidrug resistance-associated protein 2 (ABCC2) by the nuclear receptors pregnane X receptor, farnesoid X-activated receptor, and constitutive androstane receptor. J Biol Chem. 2002 Jan 25;277(4):2908-15.
• [44] Upregulation of brain expression of P-glycoprotein in MRP2-deficient TR(-) rats resembles seizure-induced up-regulation of this drug efflux transporter in normal rats. Epilepsia. 2007 Apr;48(4):631-45.
• [45] Involvement of BCRP (ABCG2) in the biliary excretion of pitavastatin. Mol Pharmacol. 2005 Sep;68(3):800-7.
• [46] Role of transporters in the tissue-selective distribution and elimination of drugs: transporters in the liver, small intestine, brain and kidney. J Control Release. 2002 Jan 17;78(1-3):43-54.
• [47] MRP2 (ABCC2) transports taxanes and confers paclitaxel resistance and both processes are stimulated by probenecid. Int J Cancer. 2005 Sep 20;116(5):824-9.
• [48] Antifolate resistance mediated by the multidrug resistance proteins MRP1 and MRP2. Cancer Res. 1999 Jun 1;59(11):2532-5.
• [49] Regorafenib is transported by the organic anion transporter 1B1 and the multidrug resistance protein 2. Biol Pharm Bull. 2015;38(4):582-6.
• [50] Expression and distribution of CYP3A genes, CYP2B22, and MDR1, MRP1, MRP2, LRP efflux transporters in brain of control and rifampicin-treated pigs. Mol Cell Biochem. 2010 Apr;337(1-2):133-43.
• [51] Involvement of multiple transporters in the hepatobiliary transport of rosuvastatin. Drug Metab Dispos. 2008 Oct;36(10):2014-23.
• [52] Evidence for two interacting ligand binding sites in human multidrug resistance protein 2 (ATP binding cassette C2). J Biol Chem. 2003 Jun 27;278(26):23538-44.
• [53] Multidrug resistance protein 2 implicates anticancer drug-resistance to sorafenib. Biol Pharm Bull. 2011;34(3):433-5.
• [54] MRP2 involvement in renal proximal tubular elimination of methylmercury mediated by DMPS or DMSA. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):10-7.
• [55] Small intestinal efflux mediated by MRP2 and BCRP shifts sulfasalazine intestinal permeability from high to low, enabling its colonic targeting. Am J Physiol Gastrointest Liver Physiol. 2009 Aug;297(2):G371-7.
• [56] Vinblastine and sulfinpyrazone export by the multidrug resistance protein MRP2 is associated with glutathione export. Br J Cancer. 2000 Aug;83(3):375-83.
• [57] Involvement of transporters in the hepatic uptake and biliary excretion of valsartan, a selective antagonist of the angiotensin II AT1-receptor, in humans. Drug Metab Dispos. 2006 Jul;34(7):1247-54.
• [58] Transport function and hepatocellular localization of mrp6 in rat liver. Mol Pharmacol. 2000 Mar;57(3):634-41.
• [59] Severe hypokalemia due to a possible drug-drug interaction between vinblastine and antiretrovirals in a HIV-infected patient with Hodgkin's lymphoma. Int J STD AIDS. 2017 Oct;28(12):1259-1262.
• [60] Purification of the human apical conjugate export pump MRP2 reconstitution and functional characterization as substrate-stimulated ATPase. Eur J Biochem. 1999 Oct 1;265(1):281-9.
• [61] Biliary excretion mechanism of CPT-11 and its metabolites in humans: involvement of primary active transporters. Cancer Res. 1998 Nov 15;58(22):5137-43.
• [62] Transport of dietary phenethyl isothiocyanate is mediated by multidrug resistance protein 2 but not P-glycoprotein. Biochem Pharmacol. 2005 Aug 15;70(4):640-7.
• [63] Transport and metabolism of the tea flavonoid (-)-epicatechin by the human intestinal cell line Caco-2. Pharm Res. 2001 Oct;18(10):1420-5.
• [64] Functional analysis of ABCA8, a new drug transporter. Biochem Biophys Res Commun. 2002 Oct 18;298(1):41-5.
• [65] Biliary excretion of phenolphthalein sulfate in rats. Pharmacology. 2003 Aug;68(4):177-82.
• [66] Possible involvement of the drug transporters P glycoprotein and multidrug resistance-associated protein Mrp2 in disposition of azithromycin. Antimicrob Agents Chemother. 2004 Mar;48(3):809-14.
• [67] Characterization of rhodamine-123, calcein and 5(6)-carboxy-2',7'-dichlorofluorescein (CDCF) export via MRP2 (ABCC2) in MES-SA and A549 cells. Eur J Pharm Sci. 2011 Aug 17;43(5):359-69.
• [68] ABCC1, ABCC2 and ABCC3 are implicated in the transepithelial transport of the myco-estrogen zearalenone and its major metabolites. Toxicol Lett. 2009 Oct 28;190(2):215-23.
• [69] Mechanistic studies on the absorption and disposition of scutellarin in humans: selective OATP2B1-mediated hepatic uptake is a likely key determinant for its unique pharmacokinetic characteristics. Drug Metab Dispos. 2012 Oct;40(10):2009-20.
• [70] Permeation of astilbin and taxifolin in Caco-2 cell and their effects on the P-gp. Int J Pharm. 2009 Aug 13;378(1-2):1-8.
• [71] ATP-dependent para-aminohippurate transport by apical multidrug resistance protein MRP2. Kidney Int. 2000 Apr;57(4):1636-42.
• [72] Transport of monoglucuronosyl and bisglucuronosyl bilirubin by recombinant human and rat multidrug resistance protein 2. Hepatology. 1999 Aug;30(2):485-90.
• [73] Differential modulation of the human liver conjugate transporters MRP2 and MRP3 by bile acids and organic anions. J Biol Chem. 2003 Jun 27;278(26):23529-37.
• [74] FDA Drug Development and Drug Interactions
• [75] Human multidrug resistance protein 2 transports the therapeutic bile salt tauroursodeoxycholate. J Pharmacol Exp Ther. 2007 Feb;320(2):893-9.
• [76] Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells. Mol Pharmacol. 1999 May;55(5):929-37.
• [77] Interaction of nonsteroidal anti-inflammatory drugs with multidrug resistance protein (MRP) 2/ABCC2- and MRP4/ABCC4-mediated methotrexate transport. J Pharmacol Exp Ther. 2007 Jan;320(1):229-35.
• [78] Are MDCK cells transfected with the human MRP2 gene a good model of the human intestinal mucosa? Pharm Res. 2002 Jun;19(6):773-9.
• [79] Contribution of multidrug resistance protein 2 (MRP2/ABCC2) to the renal excretion of p-aminohippurate (PAH) and identification of MRP4 (ABCC4) as a novel PAH transporter. J Am Soc Nephrol. 2004 Nov;15(11):2828-35.