Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTT79CX)

• DTP Name: Organic cation transporter 1 (SLC22A1)
• Gene Name: SLC22A1
• UniProt ID: O15245 (S22A1_HUMAN)
• VARIDT ID: DTD0010
• Synonyms: OCT1; SLC22A1; Solute carrier family 22 member 1; hOCT1; oct1_cds
• DTP Family:
  Major Facilitator Superfamily (MFS)
  Organic Cation Transporter (OCT) Family
• Tissue Specificity: primarily expressed on the sinusoidal (blood side) membrane of hepatocytes. OCT1 is also located on the basolateral membrane of small intestinal enterocytes, renal proximal tubular cells, and with much lower abundance in some neurons, the heart, skeletal muscle, lung, tumor cells, and basophilic granulocytes
• Sequence:
  MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
  RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
  CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
  GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
  QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
  IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
  YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
  IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
  PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
  TIYLKVQTSEPSGT
• Function: This transporter translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium.
• Endogenous Substrate(s): Primary polyamines
• TCDB ID: 2.A.1.19.29
• Gene ID: 6580
• Reactome Pathway:
  Norepinephrine Neurotransmitter Release Cycle (R-HSA-181430)
  Abacavir transmembrane transport (R-HSA-2161517)
  Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660)
  Organic cation transport (R-HSA-549127)
  Neurotransmitter clearance (R-HSA-112311)

Molecular Interaction Atlas (MIA) of This DTP

65 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acebutolol	DM0TI4U	Hypertension	BA00-BA04	Approved	[1]
Acetylcholine	DMDF79Z	Cataract	9B10	Approved	[2]
Aciclovir	DMYLOVR	Virus infection	1A24-1D9Z	Approved	[3]
Amiloride	DMRTSGP	Congestive heart failure	BD10	Approved	[4]
Atenolol	DMNKG1Z	Hypertension	BA00-BA04	Approved	[4]
Atropine	DMEN6X7	Organophosphate poisoning	NE6Z	Approved	[4]
Auranofin	DMWE2N4	Inflammatory arthritis	FA2Z	Approved	[5]
Buformin	DMX82DO	Type 2 diabetes	5A11	Approved	[6]
Cimetidine	DMH61ZB	Acid-reflux disorder	DA22	Approved	[4]
Cisplatin	DMRHGI9	Solid tumour/cancer	2A00-2F9Z	Approved	[7]
Citalopram	DM2G9AE	Depression	6A70-6A7Z	Approved	[8]
Cladribine	DM3JDRP	Hairy cell leukaemia	2A82.2	Approved	[6]
Clidinium	DMUMQZ0	Abdominal stomach pain	DD91.4	Approved	[4]
Clonidine	DM6RZ9Q	Hypertension	BA00-BA04	Approved	[9]
Codeine	DMJX6ZG	Pain	MG30-MG3Z	Approved	[10]
Cytarabine	DMZD5QR	Acute lymphoblastic leukaemia	2A85	Approved	[6]
Debrisoquin	DMC50ME	Hypertension	BA00-BA04	Approved	[11]
Desipramine	DMT2FDC	Attention deficit hyperactivity disorder	6A05.Z	Approved	[1]
Dinoprostone	DMTYOPD	Medical abortion	JA00.1Z	Approved	[12]
Disopyramide	DM5SYZP	Ventricular arrhythmias	BC71	Approved	[4]
Dopamine	DMPGUCF	Parkinson disease	8A00.0	Approved	[8]
Epinephrine	DM3KJBC	Allergy	4A80-4A85	Approved	[6]
Fenoterol	DMIP3ZV	Asthma	CA23	Approved	[4]
Fexofenadine	DM17ONX	Allergic rhinitis	CA08.0	Approved	[13]
Formoterol	DMSOURV	Asthma	CA23	Approved	[4]
Ganciclovir	DM1MBYQ	Virus infection	1A24-1D9Z	Approved	[3]
Glycopyrrolate	DM2M3ZA	Anaesthesia	9A78.6	Approved	[4]
Imatinib	DM7RJXL	Acute lymphoblastic leukaemia	2A85	Approved	[14]
Indacaterol	DMQJHR7	Chronic obstructive pulmonary disease	CA22	Approved	[4]
Ipratropium	DMFQ320	Obstructive lung disease	CA22.Z	Approved	[4]
Lamivudine	DMI347A	Chronic HBV infection	1E51.0Z	Approved	[15]
Lamotrigine	DM8SXYG	Bipolar disorder	6A60	Approved	[16]
Metformin	DM89QE1	Type-2 diabetes	5A11	Approved	[17]
Metoclopramide	DMFA5MY	Nausea	MD90	Approved	[4]
Naratriptan	DMO50U2	Migraine	8A80	Approved	[18]
Nizatidine	DMGFV3Z	Acid-reflux disorder	DA22	Approved	[4]
Norepinephrine	DMOUC09	Sepsis	1G40-1G41	Approved	[8]
Oxaliplatin	DMQNWRD	Colorectal cancer	2B91.Z	Approved	[19]
Oxyphenonium	DMMQHOZ	Visceral spasms	MD81.4	Approved	[4]
Pentamidine	DMHZJCG	Fungal infection	1F29-1F2F	Approved	[20]
Perphenazine	DMA4MRX	Schizophrenia	6A20	Approved	[4]
Phenoxybenzamine	DM8KSQH	Malignant essential hypertension	BA00	Approved	[1]
Pramipexole	DMNMW9R	Parkinson disease	8A00.0	Approved	[21]
Prazosin	DMCD9YG	Benign prostatic hyperplasia	GA90	Approved	[1]
Procainamide	DMNMXR8	Ventricular arrhythmias	BC71	Approved	[4]
Procaterol	DM1M0Q4	Asthma	CA23	Approved	[4]
Propranolol	DM79NTF	Migraine	8A80	Approved	[9]
Quinine	DMSWYF5	Malaria	1F40-1F45	Approved	[22]
Ranitidine	DM0GUSX	Peptic ulcer	DA61	Approved	[23]
Rizatriptan	DMDJMA3	Migraine	8A80	Approved	[18]
Salbutamol	DMN9CWF	Acute asthma	CA23	Approved	[4]
Sitagliptin	DMGDKXN	Type-2 diabetes	5A11	Approved	[24]
Sorafenib	DMS8IFC	Hepatocellular carcinoma	2C12.02	Approved	[25]
Sumatriptan	DMVYXR8	Migraine	8A80	Approved	[4]
Terbutaline	DMD4381	Asthma	CA23	Approved	[4]
Tiotropium	DMFDC0Q	Chronic obstructive pulmonary disease	CA22	Approved	[4]
Triamterene	DM2HU9I	Congestive heart failure	BD10	Approved	[4]
Trimethoprim	DMM7CHK	Urinary tract infection	GC08	Approved	[4]
Trospium chloride	DM32XZT	Discovery agent	N.A.	Approved	[26]
Tubocurarine	DMBZIVP	Anaesthesia	9A78.6	Approved	[6]
Varenicline	DMMUOLJ	Smoking dependence	6C4A.2	Approved	[4]
Verapamil	DMA7PEW	Hypertension	BA00-BA04	Approved	[1]
Zidovudine	DM4KI7O	Human immunodeficiency virus infection	1C62	Approved	[6]
Zolmitriptan	DM1IB4Q	Migraine	8A80	Approved	[18]
Berberine	DMC5Q8X	N. A.	N. A.	Phase 4	[27]

5 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Spermidine	DMVJNFI	Plaque psoriasis	EA90.0	Phase 3	[6]
N1-methylnicotinamide	DM16PWF	Hyperlipidemia	5C80.Z	Phase 2/3	[28]
Camostat	DMQ7UL8	Cystic fibrosis	CA25	Phase 2	[4]
Ym155	DM5Q1W4	Breast cancer	2C60-2C65	Phase 2	[29]
PGF2alpha	DM4XAU7	Solid tumour/cancer	2A00-2F9Z	Clinical trial	[30]

1 Discontinued Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Phenformin	DMQ52JG	Diabetic complication	5A2Y	Withdrawn from market	[4]

3 Preclinical Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(R)-Xamoterol	DMXWD08	Heart failure	BD10-BD13	Preclinical	[4]
(S)-Xamoterol	DM1ZQ5G	Heart failure	BD10-BD13	Preclinical	[4]
N-methylpyridinium	DMVUKEW	Colon cancer	2B90.Z	Preclinical	[31]

6 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Benzamil	DM57SVW	Discovery agent	N.A.	Investigative	[4]
Choline	DM5D9YK	Discovery agent	N.A.	Investigative	[6]
Phencyclidine	DMQBEYX	Discovery agent	N.A.	Investigative	[32]
Tetramethylammonium Ion	DMLEPYN	Discovery agent	N.A.	Investigative	[33]
Tyramine	DM4UXT1	Discovery agent	N.A.	Investigative	[6]
[14C]TEA	DM6SFYH	Discovery agent	N.A.	Investigative	[34]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	6.07E-01	-1.05E-02	-3.21E-02
Adrenocortical carcinoma	2D11.Z	Kidney	4.74E-01	-3.60E-02	-8.84E-02
Alopecia	ED70	Skin from scalp	1.81E-03	2.26E-01	6.62E-01
Alzheimer's disease	8A20	Entorhinal cortex	8.54E-01	1.24E-02	7.20E-02
Ankylosing spondylitis	FA92.0	Pheripheral blood	7.31E-01	9.11E-02	6.05E-01
Aortic stenosis	BB70	Calcified aortic valve	8.60E-01	-9.43E-03	-1.21E-01
Apnea	7A40	Hyperplastic tonsil	4.92E-01	-7.19E-02	-3.60E-01
Arthropathy	FA00-FA5Z	Peripheral blood	1.97E-01	1.18E-01	4.54E-01
Asthma	CA23	Nasal and bronchial airway	8.27E-06	1.93E-01	5.03E-01
Atopic dermatitis	EA80	Skin	2.73E-02	-7.37E-02	-5.37E-01
Autism	6A02	Whole blood	1.16E-01	-2.19E-01	-7.09E-01
Autoimmune uveitis	9A96	Peripheral monocyte	4.09E-01	-6.22E-02	-2.84E-01
Autosomal dominant monocytopenia	4B04	Whole blood	4.78E-02	-5.96E-01	-7.95E-01
Bacterial infection of gingival	1C1H	Gingival tissue	3.31E-03	1.18E-01	3.97E-01
Batten disease	5C56.1	Whole blood	7.94E-01	8.96E-02	7.70E-01
Behcet's disease	4A62	Peripheral blood	2.41E-01	5.20E-02	2.61E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	8.60E-01	1.43E-02	7.01E-02
Bladder cancer	2C94	Bladder tissue	7.62E-03	3.49E-01	1.27E+00
Breast cancer	2C60-2C6Z	Breast tissue	4.65E-16	-2.30E-01	-5.01E-01
Cardioembolic stroke	8B11.20	Whole blood	1.15E-06	9.53E-01	1.47E+00
Cervical cancer	2C77	Cervical tissue	2.83E-01	1.86E-01	4.27E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	6.09E-01	1.07E-02	9.02E-03
Chronic hepatitis C	1E51.1	Whole blood	1.97E-01	1.91E-01	1.25E+00
Chronic obstructive pulmonary disease	CA22	Lung tissue	1.48E-01	6.33E-02	3.20E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.74E-02	1.21E-01	4.40E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	8.21E-01	-3.04E-02	-1.62E-01
Colon cancer	2B90	Colon tissue	2.93E-01	-1.27E-02	-3.91E-02
Coronary artery disease	BA80-BA8Z	Peripheral blood	5.81E-01	-8.57E-02	-2.65E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	9.11E-02	4.66E-01	1.39E+00
Endometriosis	GA10	Endometrium tissue	4.21E-02	1.27E-01	3.83E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	5.54E-01	9.80E-02	5.18E-01
Familial hypercholesterolemia	5C80.00	Whole blood	3.14E-01	-3.85E-01	-9.43E-01
Gastric cancer	2B72	Gastric tissue	1.05E-01	-2.44E-01	-2.34E+00
Glioblastopma	2A00.00	Nervous tissue	6.12E-03	-2.40E-02	-7.73E-02
Glioma	2A00.0Y-2A00.0Z	White matter tissue	8.25E-03	5.15E-01	9.18E-01
Head and neck cancer	2D42	Head and neck tissue	1.94E-08	1.59E-01	6.93E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	2.29E-01	-1.32E-01	-5.78E-01
Huntington's disease	8A01.10	Whole blood	4.75E-01	-1.27E-01	-6.47E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	8.20E-02	-1.02E-01	-6.53E-01
Immunodeficiency	4A00-4A20	Peripheral blood	9.17E-01	-5.75E-02	-3.49E-01
Influenza	1.00E+30	Whole blood	3.64E-01	-9.96E-01	-9.50E-01
Interstitial cystitis	GC00.3	Bladder tissue	2.38E-01	8.90E-02	4.16E-01
Intracranial aneurysm	8B01.0	Intracranial artery	4.22E-01	6.35E-02	4.42E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	8.55E-01	2.42E-02	6.43E-02
Ischemic stroke	8B11	Peripheral blood	3.96E-02	1.10E-01	5.72E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	9.26E-01	1.15E-01	1.54E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	6.39E-01	0.00E+00	0.00E+00
Lateral sclerosis	8B60.4	Skin	5.78E-01	-6.72E-02	-2.12E-01
Liver cancer	2C12.0	Liver tissue	5.69E-68	-5.04E+00	-7.45E+00
Liver failure	DB99.7-DB99.8	Liver tissue	6.88E-04	-5.00E+00	-1.03E+01
Lung cancer	2C25	Lung tissue	1.45E-02	-7.93E-02	-2.43E-01
Lupus erythematosus	4A40	Whole blood	1.00E-11	4.89E-01	7.74E-01
Major depressive disorder	6A70-6A7Z	Whole blood	4.42E-01	3.66E-02	6.62E-02
Major depressive disorder	6A70-6A7Z	Hippocampus	5.15E-01	1.61E-02	7.93E-02
Melanoma	2C30	Skin	2.73E-01	1.64E-01	2.55E-01
Multiple myeloma	2A83.1	Bone marrow	1.15E-01	-2.20E-01	-6.45E-01
Multiple myeloma	2A83.1	Peripheral blood	6.58E-01	-8.69E-02	-4.45E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	5.44E-01	1.29E-01	3.80E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	3.14E-02	-1.03E-01	-5.15E-01
Myelofibrosis	2A20.2	Whole blood	2.36E-01	3.30E-02	1.58E-01
Myocardial infarction	BA41-BA50	Peripheral blood	7.45E-03	3.37E-01	5.37E-01
Myopathy	8C70.6	Muscle tissue	7.22E-02	-1.72E-01	-8.58E-01
Neonatal sepsis	KA60	Whole blood	2.55E-02	1.39E-01	3.12E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	3.52E-02	-4.16E-01	-9.36E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	5.28E-02	2.28E-01	5.08E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	2.94E-02	1.28E-01	1.14E+00
Olive pollen allergy	CA08.00	Peripheral blood	1.66E-01	-2.88E-01	-6.53E-01
Oral cancer	2B6E	Oral tissue	7.90E-01	-2.08E-01	-6.14E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	6.53E-01	6.72E-03	1.95E-02
Osteoporosis	FB83.1	Bone marrow	3.50E-01	-1.28E-01	-5.08E-01
Ovarian cancer	2C73	Ovarian tissue	4.36E-01	-2.57E-02	-6.60E-02
Pancreatic cancer	2C10	Pancreas	6.39E-01	-2.19E-01	-6.43E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	6.27E-01	5.04E-02	1.96E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	6.29E-01	1.67E-02	7.87E-02
Pituitary cancer	2D12	Pituitary tissue	5.03E-02	2.57E-01	7.75E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	5.81E-01	3.01E-04	8.11E-04
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	6.51E-01	1.61E-01	7.32E-01
Polycythemia vera	2A20.4	Whole blood	3.16E-11	3.71E-01	1.34E+00
Pompe disease	5C51.3	Biceps muscle	2.19E-01	2.21E-01	1.18E+00
Preterm birth	KA21.4Z	Myometrium	2.02E-01	-1.24E-01	-6.39E-01
Prostate cancer	2C82	Prostate	9.56E-01	-1.44E-01	-3.03E-01
Psoriasis	EA90	Skin	2.90E-01	-1.11E-01	-2.75E-01
Rectal cancer	2B92	Rectal colon tissue	6.71E-01	-1.26E-01	-3.59E-01
Renal cancer	2C90-2C91	Kidney	2.40E-01	-2.62E-01	-6.25E-01
Retinoblastoma	2D02.2	Uvea	7.90E-01	-3.37E-03	-2.26E-02
Rheumatoid arthritis	FA20	Synovial tissue	2.37E-01	1.03E-01	2.87E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	7.61E-01	5.26E-04	3.70E-03
Schizophrenia	6A20	Prefrontal cortex	2.25E-02	7.43E-02	2.28E-01
Schizophrenia	6A20	Superior temporal cortex	2.05E-01	-3.00E-02	-2.99E-01
Scleroderma	4A42.Z	Whole blood	2.54E-01	7.38E-02	3.02E-01
Seizure	8A60-8A6Z	Whole blood	2.52E-01	-2.52E-01	-6.14E-01
Sensitive skin	EK0Z	Skin	9.02E-01	-4.77E-02	-3.68E-01
Sepsis with septic shock	1G41	Whole blood	1.21E-01	4.52E-02	9.15E-02
Shwachman-Diamond syndrome	3A70.0	Bone marrow	6.91E-02	1.62E-01	5.93E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	4.61E-01	2.07E-01	7.86E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	7.72E-01	-1.23E-01	-7.41E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	1.46E-01	1.04E-01	7.22E-01
Skin cancer	2C30-2C3Z	Skin	1.34E-01	-9.10E-02	-1.97E-01
Thrombocythemia	3B63	Whole blood	1.24E-04	2.41E-01	1.07E+00
Thrombocytopenia	3B64	Whole blood	5.90E-01	1.63E-01	5.36E-01
Thyroid cancer	2D10	Thyroid	9.50E-04	7.31E-02	2.95E-01
Tibial muscular dystrophy	8C75	Muscle tissue	1.42E-03	-2.68E-01	-1.56E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	3.85E-01	-3.52E-02	-9.97E-02
Type 2 diabetes	5A11	Liver tissue	1.46E-01	2.34E-01	7.18E-01
Ureter cancer	2C92	Urothelium	7.23E-01	-1.33E-02	-8.12E-02
Uterine cancer	2C78	Endometrium tissue	1.05E-08	2.71E-01	7.86E-01
Vitiligo	ED63.0	Skin	4.40E-01	-7.97E-02	-2.68E-01

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Aciclovir	Approved	Proximal tubule (S2) cells-OCT1	Km = 151.2 microM	[3]
Dinoprostone	Approved	Proximal tubule (S2) cells-OCT1	Km = 0.657 microM	[30]
Ganciclovir	Approved	Proximal tubule (S2) cells-OCT1	Km = 516.2 microM	[3]
Ipratropium	Approved	Human embryonic kidney cells (HEK293)-OCT1	Km = 9 microM	[4]
Metformin	Approved	Chinese hamster ovary (CHO) cells-OCT1	Km = 2160 microM	[35]
Metformin	Approved	Human embryonic kidney cells (HEK293)-OCT1	Km = 1060 microM	[36]
Metformin	Approved	Human embryonic kidney cells (HEK293)-OCT1	Km = 1470 microM	[17]
Metformin	Approved	Human embryonic kidney cells (HEK293)-OCT1	Km = 5450 microM	[37]
Pentamidine	Approved	Chinese hamster ovary (CHO) cells-OCT1	Km = 36.4 microM	[20]
Ranitidine	Approved	Oocytes-OCT1	Km = 70 microM	[23]
Trospium chloride	Approved	Primary human bladder urothelium cells (HBU)	Km = 106 microM	[26]

Clinical Trial Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Ym155	Phase 2	Human embryonic kidney cells (HEK293)-OCT1	Km = 22.1 microM	[29]
PGF2alpha	Clinical trial	Proximal tubule (S2) cells-OCT1	Km = 0.477 microM	[30]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
[14C]TEA	Investigative	Human cervical cancer cell line (Hela)-OCT1	Km = 229 microM	[38]
[14C]TEA	Investigative	Proximal tubule (S2) cells-OCT1	Km = 566 microM	[34]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Organic cation transporter 1 DTT Info

References

• [1] Implications of genetic polymorphisms in drug transporters for pharmacotherapy. Cancer Lett. 2006 Mar 8;234(1):4-33.
• [2] Role of acetylcholine and polyspecific cation transporters in serotonin-induced bronchoconstriction in the mouse. Respir Res. 2006 Apr 12;7:65.
• [3] Human organic anion transporters and human organic cation transporters mediate renal antiviral transport. J Pharmacol Exp Ther. 2002 Mar;300(3):918-24.
• [4] Identification of novel substrates and structure-activity relationship of cellular uptake mediated by human organic cation transporters 1 and 2. J Med Chem. 2013 Sep 26;56(18):7232-42.
• [5] Selection and characterization of a human ovarian cancer cell line resistant to auranofin. Oncotarget. 2017 Oct 9;8(56):96062-96078.
• [6] Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
• [7] Cisplatin and oxaliplatin, but not carboplatin and nedaplatin, are substrates for human organic cation transporters (SLC22A1-3 and multidrug and toxin extrusion family). J Pharmacol Exp Ther. 2006 Nov;319(2):879-86.
• [8] Organic cation transporters and their pharmacokinetic and pharmacodynamic consequences. Drug Metab Pharmacokinet. 2008;23(4):243-53.
• [9] Influx Transport of Cationic Drug at the Blood-Retinal Barrier: Impact on the Retinal Delivery of Neuroprotectants. Biol Pharm Bull. 2017;40(8):1139-1145.
• [10] Association of Organic Cation Transporter 1 With Intolerance to Metformin in Type 2 Diabetes: A GoDARTS Study. Diabetes. 2015 May;64(5):1786-93.
• [11] The prototypic pharmacogenetic drug debrisoquine is a substrate of the genetically polymorphic organic cation transporter OCT1. Biochem Pharmacol. 2012 May 15;83(10):1427-34.
• [12] Are organic cation transporters capable of transporting prostaglandins? Naunyn Schmiedebergs Arch Pharmacol. 2005 Aug;372(2):125-30.
• [13] Intestinal drug transporter expression and the impact of grapefruit juice in humans. Clin Pharmacol Ther. 2007 Mar;81(3):362-70.
• [14] Pharmacologic markers and predictors of responses to imatinib therapy in patients with chronic myeloid leukemia. Leuk Lymphoma. 2008 Apr;49(4):639-42.
• [15] Relevance of the organic cation transporters 1 and 2 for antiretroviral drug therapy in human immunodeficiency virus infection. Drug Metab Dispos. 2008 Aug;36(8):1616-23.
• [16] Lamotrigine is a substrate for OCT1 in brain endothelial cells. Biochem Pharmacol. 2012 Mar 15;83(6):805-14.
• [17] Metformin is a superior substrate for renal organic cation transporter OCT2 rather than hepatic OCT1. Drug Metab Pharmacokinet. 2005 Oct;20(5):379-86.
• [18] OCT1 mediates hepatic uptake of sumatriptan and loss-of-function OCT1 polymorphisms affect sumatriptan pharmacokinetics. Clin Pharmacol Ther. 2016 Jun;99(6):633-41.
• [19] Organic cation transporters are determinants of oxaliplatin cytotoxicity. Cancer Res. 2006 Sep 1;66(17):8847-57.
• [20] Transport of dicationic drugs pentamidine and furamidine by human organic cation transporters. Drug Metab Dispos. 2009 Feb;37(2):424-30.
• [21] OCT1 polymorphism is associated with response and survival time in anti-Parkinsonian drug users. Neurogenetics. 2011 Feb;12(1):79-82.
• [22] Comparison of type I and type II organic cation transport by organic cation transporters and organic anion-transporting polypeptides. J Pharmacol Exp Ther. 2001 Jul;298(1):110-5.
• [23] Differential substrate and inhibitory activities of ranitidine and famotidine toward human organic cation transporter 1 (hOCT1; SLC22A1), hOCT2 (SLC22A2), and hOCT3 (SLC22A3). J Pharmacol Exp Ther. 2005 Dec;315(3):1288-97.
• [24] 265 effect of dietary cholesterol on gallbladder bile lithogenicity and gene expression in the enterohepatic axis of non-obese gallstone and control women. Journal of Hepatology, 2009, 50(09):S105-S106.
• [25] Upregulation of histone acetylation reverses organic anion transporter 2 repression and enhances 5-fluorouracil sensitivity in hepatocellular carcinoma
• [26] Expression of drug transporters and drug metabolizing enzymes in the bladder urothelium in man and affinity of the bladder spasmolytic trospium chloride to transporters likely involved in its pharmacokinetics. Mol Pharm. 2015 Jan 5;12(1):171-8.
• [27] Vectorial transport of the plant alkaloid berberine by double-transfected cells expressing the human organic cation transporter 1 (OCT1, SLC22A1) and the efflux pump MDR1 P-glycoprotein (ABCB1). Naunyn Schmiedebergs Arch Pharmacol. 2008 Feb;376(6):449-61.
• [28] Cloning and characterization of two human polyspecific organic cation transporters. DNA Cell Biol. 1997 Jul;16(7):871-81.
• [29] Characterization of human organic cation transporter 1 (OCT1/SLC22A1)- and OCT2 (SLC22A2)-mediated transport of 1-(2-methoxyethyl)-2-methyl-4,9-dioxo-3-(pyrazin-2-ylmethyl)- 4,9-dihydro-1H-naphtho[2,3-d]imidazolium bromide (YM155 monobromide), a novel small molecule survivin suppressant. Drug Metab Dispos. 2010 Jan;38(1):1-4.
• [30] Human organic anion transporters and human organic cation transporters mediate renal transport of prostaglandins. J Pharmacol Exp Ther. 2002 Apr;301(1):293-8.
• [31] Interaction of oral antidiabetic drugs with hepatic uptake transporters: focus on organic anion transporting polypeptides and organic cation transporter 1. Diabetes. 2008 Jun;57(6):1463-9.
• [32] Drug transporters of platinum-based anticancer agents and their clinical significance. Drug Resist Updat. 2011 Feb;14(1):22-34.
• [33] Scintillation proximity assay for measuring uptake by the human drug transporters hOCT1, hOAT3, and hOATP1B1. Anal Biochem. 2007 Jul 15;366(2):117-25.
• [34] Involvement of human organic cation transporter 1 in the hepatic uptake of 1-(2-methoxyethyl)-2-methyl-4,9-dioxo-3-(pyrazin-2-ylmethyl)-4,9-dihydro-1H-naphtho[2,3-d]imidazolium bromide (YM155 monobromide), a novel, small molecule survivin suppressant. Drug Metab Dispos. 2009 Sep;37(9):1856-63.
• [35] Expression of organic cation transporters OCT1 (SLC22A1) and OCT3 (SLC22A3) is affected by genetic factors and cholestasis in human liver. Hepatology. 2009 Oct;50(4):1227-40.
• [36] Effects of tetraalkylammonium compounds with different affinities for organic cation transporters on the pharmacokinetics of metformin. Biopharm Drug Dispos. 2007 Dec;28(9):501-10.
• [37] Genotype-dependent effects of inhibitors of the organic cation transporter, OCT1: predictions of metformin interactions. Pharmacogenomics J. 2011 Dec;11(6):400-11.
• [38] Functional characterization of an organic cation transporter (hOCT1) in a transiently transfected human cell line (HeLa). J Pharmacol Exp Ther. 1998 Jul;286(1):354-61.