Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0KDNSF)

• DOT Name: Interleukin-17 receptor B (IL17RB)
• Synonyms: IL-17 receptor B; IL-17RB; Cytokine receptor-like 4; IL-17 receptor homolog 1; IL-17Rh1; IL17Rh1; Interleukin-17B receptor; IL-17B receptor
• Gene Name: IL17RB
• Related Disease:
  X-linked intellectual disability
  Acute myelogenous leukaemia
  Adult lymphoma
  Advanced cancer
  Allergic rhinitis
  Asthma
  Benign prostatic hyperplasia
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Coffin-Siris syndrome
  Epithelial ovarian cancer
  Estrogen-receptor positive breast cancer
  Fanconi anemia complementation group A
  Fanconi's anemia
  Gastric cancer
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Lymphoma
  Nasal polyp
  Neoplasm
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Pediatric lymphoma
  Seasonal allergic rhinitis
  Sjogren syndrome
  Stomach cancer
  Ulcerative colitis
  Metastatic malignant neoplasm
  Colorectal carcinoma
  Plasma cell myeloma
  Bladder cancer
  Melanoma
  Myeloid leukaemia
  Prostate cancer
  Prostate carcinoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Type-1 diabetes
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: I17RB_HUMAN
• PDB ID: 7UWJ; 7UWK; 7UWL
• Pfam ID: PF16556 ; PF16578 ; PF08357
• Sequence:
  MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATG
  DYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWT
  FSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLW
  DPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVT
  GDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLV
  ATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICYFTEFLQNHCR
  SEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ
  DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELL
  HVKQQVSAGKRSQACHDGCCSL
• Function: Receptor for the pro-inflammatory cytokines IL17B and IL17E. May play a role in controlling the growth and/or differentiation of hematopoietic cells.
• Tissue Specificity: Expressed in several endocrine tissues, mostly in fetal and adult liver, kidney, pancreas, testis, colon, brain and small intestine; not detected in peripheral blood leukocytes, lymphoid organs, and most cell lines.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  IL-17 sig.ling pathway (hsa04657)
• Reactome Pathway: Interleukin-17 signaling (R-HSA-448424)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
X-linked intellectual disability	DISYJBY3	Definitive	Genetic Variation	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Allergic rhinitis	DIS3U9HN	Strong	Biomarker	[5]
Asthma	DISW9QNS	Strong	Biomarker	[6]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[8]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Coffin-Siris syndrome	DIS8L03H	Strong	Biomarker	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[4]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Biomarker	[11]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Biomarker	[12]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[12]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Lung cancer	DISCM4YA	Strong	Altered Expression	[15]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[15]
Lymphoma	DISN6V4S	Strong	Biomarker	[3]
Nasal polyp	DISLP3XE	Strong	Altered Expression	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[18]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[4]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[4]
Pancreatic cancer	DISJC981	Strong	Biomarker	[19]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[3]
Seasonal allergic rhinitis	DIS58KQX	Strong	Altered Expression	[20]
Sjogren syndrome	DISUBX7H	Strong	Altered Expression	[3]
Stomach cancer	DISKIJSX	Strong	Biomarker	[13]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[21]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[22]
Colorectal carcinoma	DIS5PYL0	Disputed	Biomarker	[23]
Plasma cell myeloma	DIS0DFZ0	Disputed	Biomarker	[23]
Bladder cancer	DISUHNM0	Limited	Biomarker	[24]
Melanoma	DIS1RRCY	Limited	Biomarker	[25]
Myeloid leukaemia	DISMN944	Limited	Biomarker	[26]
Prostate cancer	DISF190Y	Limited	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[24]
Thyroid cancer	DIS3VLDH	Limited	Altered Expression	[27]
Thyroid gland carcinoma	DISMNGZ0	Limited	Altered Expression	[27]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Genetic Variation	[28]
Thyroid tumor	DISLVKMD	Limited	Altered Expression	[27]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[29]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[24]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[24]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Interleukin-17 receptor B (IL17RB) decreases the response to substance of Paclitaxel.	[51]
Capecitabine	DMTS85L	Approved	Interleukin-17 receptor B (IL17RB) increases the response to substance of Capecitabine.	[51]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Interleukin-17 receptor B (IL17RB).	[30]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Interleukin-17 receptor B (IL17RB).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Interleukin-17 receptor B (IL17RB).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Interleukin-17 receptor B (IL17RB).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Interleukin-17 receptor B (IL17RB).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Interleukin-17 receptor B (IL17RB).	[35]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Interleukin-17 receptor B (IL17RB).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Interleukin-17 receptor B (IL17RB).	[37]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Interleukin-17 receptor B (IL17RB).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Interleukin-17 receptor B (IL17RB).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Interleukin-17 receptor B (IL17RB).	[39]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Interleukin-17 receptor B (IL17RB).	[40]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Interleukin-17 receptor B (IL17RB).	[41]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Interleukin-17 receptor B (IL17RB).	[42]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Interleukin-17 receptor B (IL17RB).	[43]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Interleukin-17 receptor B (IL17RB).	[44]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Interleukin-17 receptor B (IL17RB).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Interleukin-17 receptor B (IL17RB).	[46]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Interleukin-17 receptor B (IL17RB).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Interleukin-17 receptor B (IL17RB).	[31]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interleukin-17 receptor B (IL17RB).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Interleukin-17 receptor B (IL17RB).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Interleukin-17 receptor B (IL17RB).	[49]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Interleukin-17 receptor B (IL17RB).	[44]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Interleukin-17 receptor B (IL17RB).	[50]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Interleukin-17 receptor B (IL17RB).	[36]

References

• [1] CUL4B-deficiency in humans: understanding the clinical consequences of impaired Cullin 4-RING E3 ubiquitin ligase function.Mech Ageing Dev. 2011 Aug;132(8-9):366-73. doi: 10.1016/j.mad.2011.02.003. Epub 2011 Feb 23.
• [2] Leukemic IL-17RB signaling regulates leukemic survival and chemoresistance.FASEB J. 2019 Aug;33(8):9565-9576. doi: 10.1096/fj.201900099R. Epub 2019 May 28.
• [3] Interleukin-25 Axis Is Involved in the Pathogenesis of Human Primary and Experimental Murine Sjgren's Syndrome.Arthritis Rheumatol. 2018 Aug;70(8):1265-1275. doi: 10.1002/art.40500. Epub 2018 Jun 27.
• [4] Cul4 E3 ubiquitin ligase regulates ovarian cancer drug resistance by targeting the antiapoptotic protein BIRC3.Cell Death Dis. 2019 Feb 4;10(2):104. doi: 10.1038/s41419-018-1200-y.
• [5] Allergic inflammation is exacerbated by allergen-induced type 2 innate lymphoid cells in a murine model of allergic rhinitis.Rhinology. 2017 Dec 1;55(4):339-347. doi: 10.4193/Rhin17.065.
• [6] Interleukin-25 and eosinophils progenitor cell mobilization in allergic asthma.Clin Transl Allergy. 2018 Feb 13;8:5. doi: 10.1186/s13601-018-0190-2. eCollection 2018.
• [7] Stromal factors involved in human prostate cancer development, progression and castration resistance.J Cancer Res Clin Oncol. 2017 Feb;143(2):351-359. doi: 10.1007/s00432-016-2284-3. Epub 2016 Oct 27.
• [8] The expression and clinical significance of secretory leukocyte proteinase inhibitor (SLPI) in mammary carcinoma using bioinformatics analysis.Gene. 2019 Dec 15;720:144088. doi: 10.1016/j.gene.2019.144088. Epub 2019 Aug 30.
• [9] The IL-17B-IL-17 receptor B pathway promotes resistance to paclitaxel in breast tumors through activation of the ERK1/2 pathway.Oncotarget. 2017 Dec 6;8(69):113360-113372. doi: 10.18632/oncotarget.23008. eCollection 2017 Dec 26.
• [10] Interleukin-25: a cytokine linking eosinophils and adaptive immunity in Churg-Strauss syndrome.Blood. 2010 Nov 25;116(22):4523-31. doi: 10.1182/blood-2010-02-267542. Epub 2010 Aug 20.
• [11] Association of miR-1266 with recurrence/metastasis potential in estrogen receptor positive breast cancer patients.Asian Pac J Cancer Prev. 2015;16(1):291-7. doi: 10.7314/apjcp.2015.16.1.291.
• [12] CRL4 ubiquitin ligase stimulates Fanconi anemia pathway-induced single-stranded DNA-RPA signaling.BMC Cancer. 2019 Nov 5;19(1):1042. doi: 10.1186/s12885-019-6305-x.
• [13] Non-tumor tissue derived interleukin-17B activates IL-17RB/AKT/-catenin pathway to enhance the stemness of gastric cancer.Sci Rep. 2016 May 5;6:25447. doi: 10.1038/srep25447.
• [14] Non-CSCs nourish CSCs through interleukin-17E-mediated activation of NF-B and JAK/STAT3 signaling in human hepatocellular carcinoma.Cancer Lett. 2016 Jun 1;375(2):390-399. doi: 10.1016/j.canlet.2016.03.012. Epub 2016 Mar 18.
• [15] A positive feedback loop of IL-17B-IL-17RB activates ERK/-catenin to promote lung cancer metastasis.Cancer Lett. 2018 May 28;422:44-55. doi: 10.1016/j.canlet.2018.02.037. Epub 2018 Feb 26.
• [16] Elevated expression of IL-17RB and ST2 on myeloid dendritic cells is associated with a Th2-skewed eosinophilic inflammation in nasal polyps.Clin Transl Allergy. 2018 Nov 29;8:50. doi: 10.1186/s13601-018-0237-4. eCollection 2018.
• [17] Lineage tracing and targeting of IL17RB(+) tuft cell-like human colorectal cancer stem cells.Proc Natl Acad Sci U S A. 2019 Jun 25;116(26):12996-13005. doi: 10.1073/pnas.1900251116. Epub 2019 Jun 10.
• [18] Expression of IL-17A, E, and F and their receptors in non-small-cell lung cancer.J Biol Regul Homeost Agents. 2018 Sep-Oct;32(5):1105-1116.
• [19] Targeting IL-17B-IL-17RB signaling with an anti-IL-17RB antibody blocks pancreatic cancer metastasis by silencing multiple chemokines.J Exp Med. 2015 Mar 9;212(3):333-49. doi: 10.1084/jem.20141702. Epub 2015 Mar 2.
• [20] Upregulation of IL17RB during natural allergen exposure in patients with seasonal allergic rhinitis.Allergol Int. 2011 Mar;60(1):87-92. doi: 10.2332/allergolint.10-OA-0230. Epub 2011 Jan 25.
• [21] Expression and location of IL-17A, E, F and their receptors in colorectal adenocarcinoma: Comparison with benign intestinal disease.Pathol Res Pract. 2018 Apr;214(4):482-491. doi: 10.1016/j.prp.2018.03.011. Epub 2018 Mar 7.
• [22] TGF-1 secreted by Tregs in lymph nodes promotes breast cancer malignancy via up-regulation of IL-17RB.EMBO Mol Med. 2017 Dec;9(12):1660-1680. doi: 10.15252/emmm.201606914.
• [23] The emerging role for Cullin 4 family of E3 ligases in tumorigenesis.Biochim Biophys Acta Rev Cancer. 2019 Jan;1871(1):138-159. doi: 10.1016/j.bbcan.2018.11.007. Epub 2018 Dec 30.
• [24] Immune analysis of expression of IL-17 relative ligands and their receptors in bladder cancer: comparison with polyp and cystitis.BMC Immunol. 2016 Oct 3;17(1):36. doi: 10.1186/s12865-016-0174-8.
• [25] Inactivation of the CRL4-CDT2-SET8/p21 ubiquitylation and degradation axis underlies the therapeutic efficacy of pevonedistat in melanoma.EBioMedicine. 2016 Aug;10:85-100. doi: 10.1016/j.ebiom.2016.06.023. Epub 2016 Jun 16.
• [26] IL-17E, a novel proinflammatory ligand for the IL-17 receptor homolog IL-17Rh1.J Biol Chem. 2001 Jan 12;276(2):1660-4. doi: 10.1074/jbc.M008289200.
• [27] IL-17RB enhances thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression.Mol Immunol. 2017 Oct;90:126-135. doi: 10.1016/j.molimm.2017.06.034. Epub 2017 Jul 15.
• [28] Association between interleukin 17/interleukin 17 receptor gene polymorphisms and papillary thyroid cancer in Korean population.Cytokine. 2015 Feb;71(2):283-8. doi: 10.1016/j.cyto.2014.11.011. Epub 2014 Dec 5.
• [29] Association of genetic polymorphisms of interleukins with new-onset diabetes after transplantation in renal transplantation.Transplantation. 2012 May 15;93(9):900-7. doi: 10.1097/TP.0b013e3182497534.
• [30] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [31] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [32] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [33] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [36] Comparison of the global gene expression profiles produced by methylparaben, n-butylparaben and 17beta-oestradiol in MCF7 human breast cancer cells. J Appl Toxicol. 2007 Jan-Feb;27(1):67-77. doi: 10.1002/jat.1200.
• [37] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [38] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [39] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [40] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [41] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [42] Progesterone rise on HCG day in GnRH antagonist/rFSH stimulated cycles affects endometrial gene expression. Reprod Biomed Online. 2011 Mar;22(3):263-71. doi: 10.1016/j.rbmo.2010.11.002. Epub 2010 Nov 13.
• [43] mTOR inhibition reverses acquired endocrine therapy resistance of breast cancer cells at the cell proliferation and gene-expression levels. Cancer Sci. 2008 Oct;99(10):1992-2003. doi: 10.1111/j.1349-7006.2008.00955.x.
• [44] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [45] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [46] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [47] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [50] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [51] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.