General Information of Drug Off-Target (DOT) (ID: OT19S7E5)

DOT Name G2/mitotic-specific cyclin-B1 (CCNB1)
Gene Name CCNB1
UniProt ID
CCNB1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2B9R; 2JGZ; 4Y72; 4YC3; 5HQ0; 5LQF; 6GU2; 6GU3; 6GU4; 7NJ0; 8TAR; 8TAU
Pfam ID
PF02984 ; PF00134
Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV
Function Essential for the control of the cell cycle at the G2/M (mitosis) transition.
KEGG Pathway
FoxO sig.ling pathway (hsa04068 )
Cell cycle (hsa04110 )
Oocyte meiosis (hsa04114 )
p53 sig.ling pathway (hsa04115 )
Cellular senescence (hsa04218 )
Progesterone-mediated oocyte maturation (hsa04914 )
Human immunodeficiency virus 1 infection (hsa05170 )
Reactome Pathway
Polo-like kinase mediated events (R-HSA-156711 )
Golgi Cisternae Pericentriolar Stack Reorganization (R-HSA-162658 )
APC/C (R-HSA-174048 )
Regulation of APC/C activators between G1/S and early anaphase (R-HSA-176408 )
Phosphorylation of the APC/C (R-HSA-176412 )
Phosphorylation of Emi1 (R-HSA-176417 )
Condensation of Prophase Chromosomes (R-HSA-2299718 )
MASTL Facilitates Mitotic Progression (R-HSA-2465910 )
Resolution of Sister Chromatid Cohesion (R-HSA-2500257 )
Condensation of Prometaphase Chromosomes (R-HSA-2514853 )
Regulation of PLK1 Activity at G2/M Transition (R-HSA-2565942 )
Activation of NIMA Kinases NEK9, NEK6, NEK7 (R-HSA-2980767 )
Initiation of Nuclear Envelope (NE) Reformation (R-HSA-2995383 )
Nuclear Pore Complex (NPC) Disassembly (R-HSA-3301854 )
Depolymerization of the Nuclear Lamina (R-HSA-4419969 )
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest (R-HSA-6804114 )
Mitotic Prophase (R-HSA-68875 )
Cyclin A/B1/B2 associated events during G2/M transition (R-HSA-69273 )
G2/M DNA replication checkpoint (R-HSA-69478 )
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B (R-HSA-75035 )
The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 )
Transcriptional regulation by RUNX2 (R-HSA-8878166 )
E2F-enabled inhibition of pre-replication complex formation (R-HSA-113507 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Paclitaxel DMLB81S Approved G2/mitotic-specific cyclin-B1 (CCNB1) increases the response to substance of Paclitaxel. [91]
Vinblastine DM5TVS3 Approved G2/mitotic-specific cyclin-B1 (CCNB1) increases the response to substance of Vinblastine. [91]
------------------------------------------------------------------------------------
100 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [9]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [10]
Quercetin DM3NC4M Approved Quercetin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [11]
Temozolomide DMKECZD Approved Temozolomide increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [12]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [13]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [14]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [15]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [16]
Testosterone DM7HUNW Approved Testosterone decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [15]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [17]
Decitabine DMQL8XJ Approved Decitabine increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [18]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [19]
Selenium DM25CGV Approved Selenium decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [20]
Progesterone DMUY35B Approved Progesterone decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [21]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [5]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [22]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [23]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [24]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [25]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [26]
Bortezomib DMNO38U Approved Bortezomib increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [27]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [28]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [29]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [30]
Aspirin DM672AH Approved Aspirin increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [31]
Etoposide DMNH3PG Approved Etoposide decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [32]
Nicotine DMWX5CO Approved Nicotine increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [33]
Malathion DMXZ84M Approved Malathion decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [34]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [35]
Mitomycin DMH0ZJE Approved Mitomycin increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [36]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [37]
Topotecan DMP6G8T Approved Topotecan decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [38]
Gemcitabine DMSE3I7 Approved Gemcitabine decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [39]
Sulindac DM2QHZU Approved Sulindac decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [31]
Capsaicin DMGMF6V Approved Capsaicin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [40]
Lucanthone DMZLBUO Approved Lucanthone decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [41]
Palbociclib DMD7L94 Approved Palbociclib decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [42]
Pioglitazone DMKJ485 Approved Pioglitazone decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [29]
Bicalutamide DMZMSPF Approved Bicalutamide decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [43]
Colchicine DM2POTE Approved Colchicine increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [44]
Hydroxyurea DMOQVU9 Approved Hydroxyurea increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [45]
Enzalutamide DMGL19D Approved Enzalutamide decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [46]
Ritonavir DMU764S Approved Ritonavir decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [47]
Bexarotene DMOBIKY Approved Bexarotene decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [48]
Etretinate DM2CZFA Approved Etretinate decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [48]
Propofol DMB4OLE Approved Propofol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [49]
Melatonin DMKWFBT Approved Melatonin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [50]
Ciprofloxacin XR DM2NLS9 Approved Ciprofloxacin XR decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [51]
Romidepsin DMT5GNL Approved Romidepsin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [52]
Flurbiprofen DMGN4BY Approved Flurbiprofen decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [53]
Omacetaxine mepesuccinate DMPU2WX Approved Omacetaxine mepesuccinate decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [54]
Digitoxin DMWVIGP Approved Digitoxin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [55]
Mechlorethamine DM0CVXA Approved Mechlorethamine decreases the activity of G2/mitotic-specific cyclin-B1 (CCNB1). [56]
Amiloride DMRTSGP Approved Amiloride decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [57]
Desloratadine DM56YN7 Approved Desloratadine decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [58]
Riboflavin DM8YMWE Approved Riboflavin affects the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [59]
SR141716A DMCO5JZ Approved SR141716A increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [60]
Trabectedin DMG3Y89 Approved Trabectedin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [61]
Doxercalciferol DM6FG1P Approved Doxercalciferol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [62]
Silymarin DMXBYQR Phase 4 Silymarin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [63]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [23]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [64]
Camptothecin DM6CHNJ Phase 3 Camptothecin decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [38]
Seocalcitol DMKL9QO Phase 3 Seocalcitol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [65]
Rigosertib DMOSTXF Phase 3 Rigosertib decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [66]
Coprexa DMA0WEK Phase 3 Coprexa decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [67]
Triptolide DMCMDVR Phase 3 Triptolide decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [68]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [69]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [70]
Belinostat DM6OC53 Phase 2 Belinostat decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [71]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [72]
BAICALEIN DM4C7E6 Phase 2 BAICALEIN decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [73]
GDC0941 DM1YAK6 Phase 2 GDC0941 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [74]
Flavopiridol DMKSUOI Phase 2 Flavopiridol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [75]
PF-04991532 DM94NBE Phase 2 PF-04991532 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [76]
STX-140 DMJK5CT Phase 2 STX-140 increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [77]
Preverex DMZT8FS Phase 2 Preverex decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [78]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [32]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [79]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [80]
Mivebresib DMCPF90 Phase 1 Mivebresib decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [81]
LY294002 DMY1AFS Phase 1 LY294002 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [82]
Tetrandrine DMAOJBX Phase 1 Tetrandrine increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [83]
TAK-114 DMTXE19 Phase 1 TAK-114 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [84]
BETULINIC ACID DMBUI2A Phase 1 BETULINIC ACID decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [85]
GSK2816126 DMJDVW4 Phase 1 GSK2816126 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [46]
IRX4204 DM9SCME Phase 1 IRX4204 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [86]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [87]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 affects the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [88]
Flavonoid derivative 1 DMCQP0B Patented Flavonoid derivative 1 decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [11]
Steroid derivative 1 DMB0NVQ Patented Steroid derivative 1 increases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [89]
Perillyl alcohol DMFWC3O Discontinued in Phase 2 Perillyl alcohol decreases the expression of G2/mitotic-specific cyclin-B1 (CCNB1). [90]
------------------------------------------------------------------------------------
⏷ Show the Full List of 100 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Estrogen Regulates MAPK-Related Genes through Genomic and Nongenomic Interactions between IGF-I Receptor Tyrosine Kinase and Estrogen Receptor-Alpha Signaling Pathways in Human Uterine Leiomyoma Cells. J Signal Transduct. 2012;2012:204236. doi: 10.1155/2012/204236. Epub 2012 Oct 9.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Silibinin combination with arsenic strongly inhibits survival and invasiveness of human prostate carcinoma cells. Nutr Cancer. 2015;67(4):647-58. doi: 10.1080/01635581.2015.1019635. Epub 2015 Apr 14.
11 Flavones and flavonols exert cytotoxic effects on a human oesophageal adenocarcinoma cell line (OE33) by causing G2/M arrest and inducing apoptosis. Food Chem Toxicol. 2008 Jun;46(6):2042-53. doi: 10.1016/j.fct.2008.01.049. Epub 2008 Feb 7.
12 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
13 Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
14 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
15 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
16 Histone deacetylase inhibitor, suberoylanilide hydroxamic acid (Vorinostat, SAHA) profoundly inhibits the growth of human pancreatic cancer cells. Int J Cancer. 2007 Aug 1;121(3):656-65. doi: 10.1002/ijc.22558.
17 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
18 Cell cycle regulation of human endometrial stromal cells during decidualization. Reprod Sci. 2012 Aug;19(8):883-94. doi: 10.1177/1933719112438447. Epub 2012 Apr 24.
19 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
20 Selenite and selenomethionine promote HL-60 cell cycle progression. J Nutr. 2002 Apr;132(4):674-9. doi: 10.1093/jn/132.4.674.
21 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
22 Gene expression profiles with activation of the estrogen receptor alpha-selective estrogen receptor modulator complex in breast cancer cells expressing wild-type estrogen receptor. Cancer Res. 2002 Aug 1;62(15):4419-26.
23 Influence of resveratrol on rheumatoid fibroblast-like synoviocytes analysed with gene chip transcription. Phytomedicine. 2013 Feb 15;20(3-4):310-8. doi: 10.1016/j.phymed.2012.09.020. Epub 2012 Nov 6.
24 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
25 Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
26 Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
27 Cell death by bortezomib-induced mitotic catastrophe in natural killer lymphoma cells. Mol Cancer Ther. 2008 Dec;7(12):3807-15. doi: 10.1158/1535-7163.MCT-08-0641.
28 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
29 Thiazolidinediones inhibit proliferation of microvascular and macrovascular cells by a PPARgamma-independent mechanism. Diabetologia. 2005 Mar;48(3):586-94. doi: 10.1007/s00125-005-1672-z. Epub 2005 Feb 24.
30 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
31 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
32 Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
33 Long-term nicotine exposure-induced chemoresistance is mediated by activation of Stat3 and downregulation of ERK1/2 via nAChR and beta-adrenoceptors in human bladder cancer cells. Toxicol Sci. 2010 May;115(1):118-30. doi: 10.1093/toxsci/kfq028. Epub 2010 Jan 27.
34 The protective effects of the antioxidant N-acetylcysteine (NAC) against oxidative stress-associated apoptosis evoked by the organophosphorus insecticide malathion in normal human astrocytes. Toxicology. 2019 Apr 1;417:1-14.
35 Cell cycle effects of nonsteroidal anti-inflammatory drugs and enhanced growth inhibition in combination with gemcitabine in pancreatic carcinoma cells. J Pharmacol Exp Ther. 2001 Sep;298(3):976-85.
36 Genomic and proteomic profiling of responses to toxic metals in human lung cells. Environ Health Perspect. 2003 May;111(6):825-35.
37 Azacytidine induces cell cycle arrest and suppression of neuroendocrine markers in carcinoids. Int J Clin Exp Med. 2010 Mar 28;3(2):95-102.
38 p63 involvement in poly(ADP-ribose) polymerase 1 signaling of topoisomerase I-dependent DNA damage in carcinoma cells. Biochem Pharmacol. 2013 Apr 1;85(7):999-1006. doi: 10.1016/j.bcp.2013.01.019. Epub 2013 Jan 29.
39 A fine-needle aspirate-based vulnerability assay identifies polo-like kinase 1 as a mediator of gemcitabine resistance in pancreatic cancer. Mol Cancer Ther. 2010 Feb;9(2):311-8. doi: 10.1158/1535-7163.MCT-09-0693. Epub 2010 Jan 26.
40 Capsaicin sensitizes malignant glioma cells to TRAIL-mediated apoptosis via DR5 upregulation and survivin downregulation. Carcinogenesis. 2010 Mar;31(3):367-75. doi: 10.1093/carcin/bgp298. Epub 2009 Nov 25.
41 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
42 Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
43 Androgen receptor regulates Cdc6 in synchronized LNCaP cells progressing from G1 to S phase. J Cell Physiol. 2005 Aug;204(2):381-7. doi: 10.1002/jcp.20422.
44 Synthesis and antitumor evaluation of nitrovinyl biphenyls: anticancer agents based on allocolchicines. ChemMedChem. 2011 May 2;6(5):859-68. doi: 10.1002/cmdc.201100019. Epub 2011 Apr 6.
45 The potential of iron chelators of the pyridoxal isonicotinoyl hydrazone class as effective antiproliferative agents, IV: The mechanisms involved in inhibiting cell-cycle progression. Blood. 2001 Aug 1;98(3):842-50. doi: 10.1182/blood.v98.3.842.
46 Dual targeting of EZH2 and androgen receptor as a novel therapy for castration-resistant prostate cancer. Toxicol Appl Pharmacol. 2020 Oct 1;404:115200. doi: 10.1016/j.taap.2020.115200. Epub 2020 Aug 14.
47 Ritonavir blocks AKT signaling, activates apoptosis and inhibits migration and invasion in ovarian cancer cells. Mol Cancer. 2009 Apr 22;8:26. doi: 10.1186/1476-4598-8-26.
48 Bexarotene activates the p53/p73 pathway in human cutaneous T-cell lymphoma. Br J Dermatol. 2009 Mar;160(3):519-26. doi: 10.1111/j.1365-2133.2008.08931.x. Epub 2008 Nov 25.
49 Evaluation of cytotoxicity of propofol and its related mechanism in glioblastoma cells and astrocytes. Environ Toxicol. 2017 Dec;32(12):2440-2454.
50 Melatonin delays cell proliferation by inducing G1 and G2 /M phase arrest in a human osteoblastic cell line hFOB 1.19. J Pineal Res. 2011 Mar;50(2):222-31. doi: 10.1111/j.1600-079X.2010.00832.x. Epub 2010 Nov 25.
51 Ciprofloxacin mediated cell growth inhibition, S/G2-M cell cycle arrest, and apoptosis in a human transitional cell carcinoma of the bladder cell line. Clin Cancer Res. 2000 Mar;6(3):891-900.
52 Abrogation of p21 expression by flavopiridol enhances depsipeptide-mediated apoptosis in malignant pleural mesothelioma cells. Clin Cancer Res. 2004 Mar 1;10(5):1813-25. doi: 10.1158/1078-0432.ccr-0901-3.
53 Inhibition of human brain tumor cell growth by the anti-inflammatory drug, flurbiprofen. Oncogene. 2001 Oct 18;20(47):6864-70.
54 Homoharringtonine suppresses LoVo cell growth by inhibiting EphB4 and the PI3K/AKT and MAPK/EKR1/2 signaling pathways. Food Chem Toxicol. 2020 Feb;136:110960. doi: 10.1016/j.fct.2019.110960. Epub 2019 Nov 11.
55 Digitoxin and a synthetic monosaccharide analog inhibit cell viability in lung cancer cells. Toxicol Appl Pharmacol. 2012 Jan 1;258(1):51-60. doi: 10.1016/j.taap.2011.10.007. Epub 2011 Oct 18.
56 G2 delay induced by nitrogen mustard in human cells affects cyclin A/cdk2 and cyclin B1/cdc2-kinase complexes differently. J Biol Chem. 1993 Apr 15;268(11):8298-308.
57 Reduction in the radiation-induced late S phase and G2 blocks in HL-60 cell populations by amiloride, an efficient inhibitor of the Na+/H+ transporter. Cancer Res. 1998 Feb 1;58(3):413-20.
58 Blockade of NMT1 enzymatic activity inhibits N-myristoylation of VILIP3 protein and suppresses liver cancer progression. Signal Transduct Target Ther. 2023 Jan 9;8(1):14. doi: 10.1038/s41392-022-01248-9.
59 Riboflavin depletion impairs cell proliferation in adult human duodenum: identification of potential effectors. Dig Dis Sci. 2011 Apr;56(4):1007-19. doi: 10.1007/s10620-010-1374-3. Epub 2010 Sep 17.
60 Rimonabant inhibits human colon cancer cell growth and reduces the formation of precancerous lesions in the mouse colon. Int J Cancer. 2009 Sep 1;125(5):996-1003. doi: 10.1002/ijc.24483.
61 Selective effects of the anticancer drug Yondelis (ET-743) on cell-cycle promoters. Mol Pharmacol. 2005 Nov;68(5):1496-503. doi: 10.1124/mol.105.013615. Epub 2005 Jun 16.
62 KML001 and doxercalciferol induce synergistic antileukemic effect in acute lymphoid leukemia cells. Oncol Rep. 2017 Jul;38(1):481-487. doi: 10.3892/or.2017.5688. Epub 2017 Jun 1.
63 Identifying the differential effects of silymarin constituents on cell growth and cell cycle regulatory molecules in human prostate cancer cells. Int J Cancer. 2008 Jul 1;123(1):41-50. doi: 10.1002/ijc.23485.
64 Androgen responsive and refractory prostate cancer cells exhibit distinct curcumin regulated transcriptome. Cancer Biol Ther. 2008 Sep;7(9):1427-35. doi: 10.4161/cbt.7.9.6469. Epub 2008 Sep 4.
65 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
66 Evaluation of the novel mitotic modulator ON 01910.Na in pancreatic cancer and preclinical development of an ex vivo predictive assay. Oncogene. 2009 Jan 29;28(4):610-8. doi: 10.1038/onc.2008.424. Epub 2008 Nov 24.
67 Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
68 Triptolide inhibits the growth and metastasis of solid tumors. Mol Cancer Ther. 2003 Jan;2(1):65-72.
69 Regulation of genistein-induced differentiation in human acute myeloid leukaemia cells (HL60, NB4) Protein kinase modulation and reactive oxygen species generation. Biochem Pharmacol. 2009 Feb 1;77(3):384-96. doi: 10.1016/j.bcp.2008.10.035. Epub 2008 Nov 6.
70 Thymoquinone suppresses invasion and metastasis in bladder cancer cells by reversing EMT through the Wnt/-catenin signaling pathway. Chem Biol Interact. 2020 Apr 1;320:109022. doi: 10.1016/j.cbi.2020.109022. Epub 2020 Feb 27.
71 Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
72 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
73 Baicalein induces cancer cell death and proliferation retardation by the inhibition of CDC2 kinase and survivin associated with opposite role of p38 mitogen-activated protein kinase and AKT. Mol Cancer Ther. 2007 Nov;6(11):3039-48. doi: 10.1158/1535-7163.MCT-07-0281.
74 Nuclear phospho-Akt increase predicts synergy of PI3K inhibition and doxorubicin in breast and ovarian cancer. Sci Transl Med. 2010 Sep 8;2(48):48ra66. doi: 10.1126/scitranslmed.3000630.
75 Flavopiridol down-regulates antiapoptotic proteins and sensitizes human breast cancer cells to epothilone B-induced apoptosis. Cancer Res. 2003 Jan 1;63(1):93-9.
76 In vitro antitumor mechanism of (E)-N-(2-methoxy-5-(((2,4,6-trimethoxystyryl)sulfonyl)methyl)pyridin-3-yl)methanesulfonamide. Mol Pharmacol. 2015 Jan;87(1):18-30. doi: 10.1124/mol.114.093245. Epub 2014 Oct 14.
77 STX140 is efficacious in vitro and in vivo in taxane-resistant breast carcinoma cells. Clin Cancer Res. 2008 Jan 15;14(2):597-606. doi: 10.1158/1078-0432.CCR-07-1717.
78 Mechanisms underlying effect of the mycotoxin cytochalasin B on induction of cytotoxicity, modulation of cell cycle, Ca(2+) homeostasis and ROS production in human breast cells. Toxicology. 2016 Aug 31;370:1-19. doi: 10.1016/j.tox.2016.09.006. Epub 2016 Oct 1.
79 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
80 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
81 Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
82 Deoxynivalenol induces apoptosis and autophagy in human prostate epithelial cells via PI3K/Akt signaling pathway. Arch Toxicol. 2022 Jan;96(1):231-241. doi: 10.1007/s00204-021-03176-z. Epub 2021 Oct 22.
83 Tetrandrine and cepharanthine induce apoptosis through caspase cascade regulation, cell cycle arrest, MAPK activation and PI3K/Akt/mTOR signal modification in glucocorticoid resistant human leukemia Jurkat T cells. Chem Biol Interact. 2019 Sep 1;310:108726. doi: 10.1016/j.cbi.2019.108726. Epub 2019 Jun 28.
84 Natura-alpha targets forkhead box m1 and inhibits androgen-dependent and -independent prostate cancer growth and invasion. Clin Cancer Res. 2011 Jul 1;17(13):4414-24. doi: 10.1158/1078-0432.CCR-11-0431. Epub 2011 May 23.
85 Hypoxia increases the apoptotic response to betulinic acid and betulin in human non-small cell lung cancer cells. Chem Biol Interact. 2021 Jan 5;333:109320. doi: 10.1016/j.cbi.2020.109320. Epub 2020 Nov 9.
86 A retinoid X receptor (RXR)-selective retinoid reveals that RXR-alpha is potentially a therapeutic target in breast cancer cell lines, and that it potentiates antiproliferative and apoptotic responses to peroxisome proliferator-activated receptor ligands. Breast Cancer Res. 2004;6(5):R546-55. doi: 10.1186/bcr913. Epub 2004 Jul 23.
87 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
88 Cyclin-mediated G1 arrest by celecoxib differs in low-versus high-grade bladder cancer. Anticancer Res. 2009 Oct;29(10):3769-75.
89 2-methoxyestradiol induces mitotic arrest, apoptosis, and synergistic cytotoxicity with arsenic trioxide in human urothelial carcinoma cells. PLoS One. 2013 Aug 13;8(8):e68703. doi: 10.1371/journal.pone.0068703. eCollection 2013.
90 Cell cycle arrest by the isoprenoids perillyl alcohol, geraniol, and farnesol is mediated by p21(Cip1) and p27(Kip1) in human pancreatic adenocarcinoma cells. J Pharmacol Exp Ther. 2007 Mar;320(3):1163-70. doi: 10.1124/jpet.106.111666. Epub 2006 Nov 30.
91 E2F-1 overexpression in U2OS cells increases cyclin B1 levels and cdc2 kinase activity and sensitizes cells to antimitotic agents. Cancer Res. 2006 Jul 15;66(14):7253-60. doi: 10.1158/0008-5472.CAN-05-3725.