Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1ABI9N)

• DOT Name: Krueppel-like factor 5 (KLF5)
• Synonyms: Basic transcription element-binding protein 2; BTE-binding protein 2; Colon krueppel-like factor; GC-box-binding protein 2; Intestinal-enriched krueppel-like factor; Transcription factor BTEB2
• Gene Name: KLF5
• Related Disease:
  Bladder cancer
  Lung adenocarcinoma
  Acute myelogenous leukaemia
  Arteriosclerosis
  Atherosclerosis
  Barrett esophagus
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Cardiovascular disease
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal adenocarcinoma
  Colorectal adenoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal carcinoma
  Colorectal neoplasm
  Gastric adenocarcinoma
  Glioma
  Hepatocellular carcinoma
  Laryngeal carcinoma
  Lung cancer
  Lung carcinoma
  Osteosarcoma
  Pancreatic tumour
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Rectal carcinoma
  Schizophrenia
  Urinary bladder cancer
  Urinary bladder neoplasm
  Chronic obstructive pulmonary disease
  Non-small-cell lung cancer
  Estrogen-receptor positive breast cancer
  Squamous cell carcinoma
  Gastric cancer
  Pancreatic cancer
  Stomach cancer
  Systemic sclerosis
  Triple negative breast cancer
• UniProt ID: KLF5_HUMAN
• PDB ID: 2EBT
• Pfam ID: PF00096
• Sequence:
  MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
  QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
  DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
  APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
  SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
  PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
  RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
  TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
• Function: Transcription factor that binds to GC box promoter elements. Activates the transcription of these genes.
• Tissue Specificity: Expressed only in testis and placenta.
• KEGG Pathway: Chemical carcinogenesis - receptor activation (hsa05207)
• Reactome Pathway:
  Transcriptional regulation of granulopoiesis (R-HSA-9616222)
  Transcriptional regulation of white adipocyte differentiation (R-HSA-381340)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder cancer	DISUHNM0	Definitive	Altered Expression	[1]
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[3]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[4]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[4]
Barrett esophagus	DIS416Y7	Strong	Biomarker	[5]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Carcinoma	DISH9F1N	Strong	Biomarker	[8]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[9]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[10]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[10]
Colon cancer	DISVC52G	Strong	Genetic Variation	[11]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[12]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[11]
Colorectal adenoma	DISTSVHM	Strong	Genetic Variation	[11]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[11]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[11]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[11]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[13]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[11]
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[14]
Glioma	DIS5RPEH	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[17]
Lung cancer	DISCM4YA	Strong	Altered Expression	[18]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[18]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[6]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[20]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[21]
Rectal carcinoma	DIS8FRR7	Strong	Biomarker	[22]
Schizophrenia	DISSRV2N	Strong	Biomarker	[23]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[1]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[1]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[24]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Posttranslational Modification	[25]
Estrogen-receptor positive breast cancer	DIS1H502	Disputed	Altered Expression	[26]
Squamous cell carcinoma	DISQVIFL	Disputed	Biomarker	[27]
Gastric cancer	DISXGOUK	Limited	Biomarker	[28]
Pancreatic cancer	DISJC981	Limited	Biomarker	[29]
Stomach cancer	DISKIJSX	Limited	Biomarker	[28]
Systemic sclerosis	DISF44L6	Limited	Biomarker	[30]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[31]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cyclophosphamide	DM4O2Z7	Approved	Krueppel-like factor 5 (KLF5) affects the response to substance of Cyclophosphamide.	[61]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Krueppel-like factor 5 (KLF5).	[32]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Krueppel-like factor 5 (KLF5).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Krueppel-like factor 5 (KLF5).	[34]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Krueppel-like factor 5 (KLF5).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Krueppel-like factor 5 (KLF5).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Krueppel-like factor 5 (KLF5).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Krueppel-like factor 5 (KLF5).	[38]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Krueppel-like factor 5 (KLF5).	[39]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Krueppel-like factor 5 (KLF5).	[40]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Krueppel-like factor 5 (KLF5).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Krueppel-like factor 5 (KLF5).	[42]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Krueppel-like factor 5 (KLF5).	[43]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Krueppel-like factor 5 (KLF5).	[44]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Krueppel-like factor 5 (KLF5).	[45]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Krueppel-like factor 5 (KLF5).	[46]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Krueppel-like factor 5 (KLF5).	[47]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Krueppel-like factor 5 (KLF5).	[48]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Krueppel-like factor 5 (KLF5).	[49]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Krueppel-like factor 5 (KLF5).	[50]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Krueppel-like factor 5 (KLF5).	[51]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Krueppel-like factor 5 (KLF5).	[45]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Krueppel-like factor 5 (KLF5).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Krueppel-like factor 5 (KLF5).	[53]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Krueppel-like factor 5 (KLF5).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Krueppel-like factor 5 (KLF5).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Krueppel-like factor 5 (KLF5).	[57]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Krueppel-like factor 5 (KLF5).	[57]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Krueppel-like factor 5 (KLF5).	[58]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of Krueppel-like factor 5 (KLF5).	[59]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Krueppel-like factor 5 (KLF5).	[60]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Krueppel-like factor 5 (KLF5).	[55]

References

• [1] miR-5195-3p Inhibits Proliferation and Invasion of Human Bladder Cancer Cells by Directly Targeting Oncogene KLF5.Oncol Res. 2017 Aug 7;25(7):1081-1087. doi: 10.3727/096504016X14831120463349. Epub 2017 Jan 20.
• [2] Elevated Krppel-like factor 5 expression in spatiotemporal mouse lungs is similar to human congenital cystic adenomatoid malformation of the lungs.J Int Med Res. 2018 Jul;46(7):2856-2865. doi: 10.1177/0300060518774998. Epub 2018 Jun 13.
• [3] MicroRNA-21 promotes proliferation in acute myeloid leukemia by targeting Krppel-like factor 5.Oncol Lett. 2019 Sep;18(3):3367-3372. doi: 10.3892/ol.2019.10667. Epub 2019 Jul 25.
• [4] mircroRNA-152 prevents the malignant progression of atherosclerosis via down-regulation of KLF5.Biomed Pharmacother. 2019 Jan;109:2409-2414. doi: 10.1016/j.biopha.2018.08.014. Epub 2018 Nov 30.
• [5] Krppel-like Factor 5 Promotes Sonic Hedgehog Signaling and Neoplasia in Barrett's Esophagus and Esophageal Adenocarcinoma.Transl Oncol. 2019 Nov;12(11):1432-1441. doi: 10.1016/j.tranon.2019.07.006. Epub 2019 Aug 8.
• [6] MicroRNA-493-5p inhibits proliferation and metastasis of osteosarcoma cells by targeting Kruppel-like factor 5.J Cell Physiol. 2019 Aug;234(8):13525-13533. doi: 10.1002/jcp.28030. Epub 2019 Feb 17.
• [7] USP3 promotes breast cancer cell proliferation by deubiquitinating KLF5.J Biol Chem. 2019 Nov 22;294(47):17837-17847. doi: 10.1074/jbc.RA119.009102. Epub 2019 Oct 17.
• [8] Krpple-like factor 5 is essential for mammary gland development and tumorigenesis.J Pathol. 2018 Dec;246(4):497-507. doi: 10.1002/path.5153. Epub 2018 Nov 5.
• [9] Regulatory polymorphism in transcription factor KLF5 at the MEF2 element alters the response to angiotensin II and is associated with human hypertension.FASEB J. 2010 Jun;24(6):1780-8. doi: 10.1096/fj.09-146589. Epub 2010 Jan 19.
• [10] MicroRNA-152 Acts as a Tumor Suppressor MicroRNA by Inhibiting Krppel-Like Factor 5 in Human Cervical Cancer.Oncol Res. 2019 Feb 21;27(3):335-340. doi: 10.3727/096504018X15252202178408. Epub 2018 Aug 21.
• [11] Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
• [12] Ascl2 activation by YAP1/KLF5 ensures the self-renewability of colon cancer progenitor cells.Oncotarget. 2017 Nov 27;8(65):109301-109318. doi: 10.18632/oncotarget.22673. eCollection 2017 Dec 12.
• [13] EGFR and Prion protein promote signaling via FOXO3a-KLF5 resulting in clinical resistance to platinum agents in colorectal cancer.Mol Oncol. 2019 Apr;13(4):725-737. doi: 10.1002/1878-0261.12411. Epub 2019 Feb 8.
• [14] CDX1/2 and KLF5 Expression and Epigenetic Modulation of Sonic Hedgehog Signaling in Gastric Adenocarcinoma.Pathol Oncol Res. 2019 Jul;25(3):1215-1222. doi: 10.1007/s12253-019-00594-4. Epub 2019 Jan 26.
• [15] MKK7 transcription positively or negatively regulated by SP1 and KLF5 depends on HDAC4 activity in glioma.Int J Cancer. 2019 Nov 1;145(9):2496-2508. doi: 10.1002/ijc.32321. Epub 2019 May 3.
• [16] Eukaryotic elongation factor 2 kinase promotes angiogenesis in hepatocellular carcinoma via PI3K/Akt and STAT3.Int J Cancer. 2020 Mar 1;146(5):1383-1395. doi: 10.1002/ijc.32560. Epub 2019 Jul 22.
• [17] KLF5 silence attenuates proliferation and epithelial-mesenchymal transition induction in Hep-2 cells through NF-B signaling pathway.Eur Rev Med Pharmacol Sci. 2019 May;23(9):3867-3875. doi: 10.26355/eurrev_201905_17814.
• [18] Krppel-like factor 5 promotes lung tumorigenesis through upregulation of Sox4.Cell Physiol Biochem. 2014;33(1):1-10. doi: 10.1159/000356645. Epub 2014 Jan 2.
• [19] Common variation at 2p13.3, 3q29, 7p13 and 17q25.1 associated with susceptibility to pancreatic cancer.Nat Genet. 2015 Aug;47(8):911-6. doi: 10.1038/ng.3341. Epub 2015 Jun 22.
• [20] Upregulation of MicroRNA-21 promotes tumorigenesis of prostate cancer cells by targeting KLF5.Cancer Biol Ther. 2019;20(8):1149-1161. doi: 10.1080/15384047.2019.1599659. Epub 2019 Apr 19.
• [21] KLF5 inhibits angiogenesis in PTEN-deficient prostate cancer by attenuating AKT activation and subsequent HIF1 accumulation.Mol Cancer. 2015 Apr 21;14:91. doi: 10.1186/s12943-015-0365-6.
• [22] CORRIGENDUM: Correction of 4th author's name: The Krppel-like factor (KLF5) as a predictive biomarker in preoperative chemoradiation therapy for rectal cancer.Ann Surg Treat Res. 2019 Sep;97(3):157. doi: 10.4174/astr.2019.97.3.157. Epub 2019 Aug 29.
• [23] Expression of Kruppel-like factor 5 gene in human brain and association of the gene with the susceptibility to schizophrenia.Schizophr Res. 2008 Mar;100(1-3):291-301. doi: 10.1016/j.schres.2007.11.042. Epub 2008 Jan 15.
• [24] miR-145-5p is associated with smoke-related chronic obstructive pulmonary disease via targeting KLF5.Chem Biol Interact. 2019 Feb 25;300:82-90. doi: 10.1016/j.cbi.2019.01.011. Epub 2019 Jan 9.
• [25] Knockdown of KLF5 promotes cisplatin-induced cell apoptosis via regulating DNA damage checkpoint proteins in non-small cell lung cancer.Thorac Cancer. 2019 May;10(5):1069-1077. doi: 10.1111/1759-7714.13046. Epub 2019 Mar 21.
• [26] Oestrogen causes degradation of KLF5 by inducing the E3 ubiquitin ligase EFP in ER-positive breast cancer cells.Biochem J. 2011 Jul 15;437(2):323-33. doi: 10.1042/BJ20101388.
• [27] Distinct patterns of somatic genome alterations in lung adenocarcinomas and squamous cell carcinomas.Nat Genet. 2016 Jun;48(6):607-16. doi: 10.1038/ng.3564. Epub 2016 May 9.
• [28] Crocin inhibits the migration, invasion, and epithelial-mesenchymal transition of gastric cancer cells via miR-320/KLF5/HIF-1 signaling.J Cell Physiol. 2019 Aug;234(10):17876-17885. doi: 10.1002/jcp.28418. Epub 2019 Mar 9.
• [29] Overexpression of KLF5 is associated with poor survival and G1/S progression in pancreatic cancer.Aging (Albany NY). 2019 Jul 21;11(14):5035-5057. doi: 10.18632/aging.102096.
• [30] Recent advances in animal models of systemic sclerosis.J Dermatol. 2016 Jan;43(1):19-28. doi: 10.1111/1346-8138.13185.
• [31] Mithramycin A suppresses basal triple-negative breast cancer cell survival partially via down-regulating Krppel-like factor 5 transcription by Sp1.Sci Rep. 2018 Jan 18;8(1):1138. doi: 10.1038/s41598-018-19489-6.
• [32] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [33] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [34] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [35] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [39] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [40] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [41] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [42] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [43] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [44] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [45] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [46] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [47] Cell death mechanisms of the anti-cancer drug etoposide on human cardiomyocytes isolated from pluripotent stem cells. Arch Toxicol. 2018 Apr;92(4):1507-1524.
• [48] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [51] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [52] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [53] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [54] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [55] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [56] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [57] Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
• [58] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [59] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
• [60] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [61] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.