Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1VMRFQ)

• DOT Name: Septin-9 (SEPTIN9)
• Synonyms: MLL septin-like fusion protein MSF-A; MLL septin-like fusion protein; Ovarian/Breast septin; Ov/Br septin; Septin D1
• Gene Name: SEPTIN9
• Related Disease:
  Acute leukaemia
  Acute monocytic leukemia
  Adenocarcinoma
  Adenoma
  Amyotrophic neuralgia
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Cardiovascular disease
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colorectal neoplasm
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Metastatic malignant neoplasm
  Myelodysplastic syndrome
  Myocardial infarction
  Obesity
  Ovarian neoplasm
  Pancreatic cancer
  Peripheral neuropathy
  Polyp
  Prostate cancer
  Prostate carcinoma
  T-cell lymphoma
  Brain neoplasm
  Head-neck squamous cell carcinoma
  Leukemia
  Lung cancer
  Lung carcinoma
  Neuralgic amyotrophy
  Squamous cell carcinoma
  Acute myelogenous leukaemia
  Arteriosclerosis
  Colon adenocarcinoma
  Colorectal adenoma
  Hepatocellular carcinoma
  leukaemia
  Malaria
  Nervous system disease
  Rectal carcinoma
  Type-1/2 diabetes
• UniProt ID: SEPT9_HUMAN
• PDB ID: 4YQF; 5CYO; 5CYP
• Pfam ID: PF00735
• Sequence:
  MKKSYSGGTRTSSGRLRRLGDSSGPALKRSFEVEEVETPNSTPPRRVQTPLLRATVASST
  QKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVE
  NAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESAHRRMEPPASKVPEVPTAPA
  TDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQE
  ATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFN
  IMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTV
  IDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGH
  SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDE
  DSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLL
  IRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM
• Function: Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.
• Tissue Specificity: Widely expressed. Isoforms are differentially expressed in testes, kidney, liver heart, spleen, brain, peripheral blood leukocytes, skeletal muscle and kidney. Specific isoforms appear to demonstrate tissue specificity. Isoform 5 is the most highly expressed in fetal tissue. Isoform 1 is detected in all tissues except the brain and thymus, while isoform 2, isoform 3, and isoform 4 are detected at low levels in approximately half of the fetal tissues.
• KEGG Pathway:
  Bacterial invasion of epithelial cells (hsa05100)
  Shigellosis (hsa05131)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute leukaemia	DISDQFDI	Strong	Genetic Variation	[1]
Acute monocytic leukemia	DIS28NEL	Strong	Genetic Variation	[2]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[3]
Adenoma	DIS78ZEV	Strong	Biomarker	[4]
Amyotrophic neuralgia	DISOTIUZ	Strong	Autosomal dominant	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Carcinoma	DISH9F1N	Strong	Altered Expression	[7]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[8]
Cervical cancer	DISFSHPF	Strong	Biomarker	[9]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[9]
Colon cancer	DISVC52G	Strong	Biomarker	[10]
Colorectal neoplasm	DISR1UCN	Strong	Posttranslational Modification	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[13]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[14]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[6]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[15]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[16]
Obesity	DIS47Y1K	Strong	Biomarker	[17]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[18]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[19]
Peripheral neuropathy	DIS7KN5G	Strong	Genetic Variation	[20]
Polyp	DISRSLYF	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
T-cell lymphoma	DISSXRTQ	Strong	Biomarker	[1]
Brain neoplasm	DISY3EKS	moderate	Altered Expression	[23]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Biomarker	[24]
Leukemia	DISNAKFL	moderate	Biomarker	[25]
Lung cancer	DISCM4YA	moderate	Posttranslational Modification	[26]
Lung carcinoma	DISTR26C	moderate	Posttranslational Modification	[26]
Neuralgic amyotrophy	DISYRI69	Moderate	Autosomal dominant	[27]
Squamous cell carcinoma	DISQVIFL	moderate	Genetic Variation	[28]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[29]
Arteriosclerosis	DISK5QGC	Limited	Genetic Variation	[30]
Colon adenocarcinoma	DISDRE0J	Limited	Posttranslational Modification	[31]
Colorectal adenoma	DISTSVHM	Limited	Posttranslational Modification	[32]
Hepatocellular carcinoma	DIS0J828	Limited	Posttranslational Modification	[33]
leukaemia	DISS7D1V	Limited	Biomarker	[25]
Malaria	DISQ9Y50	Limited	Genetic Variation	[34]
Nervous system disease	DISJ7GGT	Limited	Genetic Variation	[35]
Rectal carcinoma	DIS8FRR7	Limited	Biomarker	[36]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[30]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Septin-9 (SEPTIN9).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Septin-9 (SEPTIN9).	[39]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Septin-9 (SEPTIN9).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Septin-9 (SEPTIN9).	[41]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Septin-9 (SEPTIN9).	[42]
Dopamine	DMPGUCF	Approved	Dopamine decreases the expression of Septin-9 (SEPTIN9).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Septin-9 (SEPTIN9).	[44]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Septin-9 (SEPTIN9).	[45]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Septin-9 (SEPTIN9).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Septin-9 (SEPTIN9).	[47]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Septin-9 (SEPTIN9).	[48]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Septin-9 (SEPTIN9).	[49]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Septin-9 (SEPTIN9).	[38]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Septin-9 (SEPTIN9).	[50]

References

• [1] Fusion of MLL and MSF in adult de novo acute myelomonocytic leukemia (M4) with t(11;17)(q23;q25).Int J Hematol. 2002 Jun;75(5):503-7. doi: 10.1007/BF02982114.
• [2] A variant-type MLL/SEPT9 fusion transcript in adult de novo acute monocytic leukemia (M5b) with t(11;17)(q23;q25).Int J Hematol. 2008 Sep;88(2):192-196. doi: 10.1007/s12185-008-0133-0. Epub 2008 Jul 19.
• [3] The Septin 9 (MSF) gene is amplified and overexpressed in mouse mammary gland adenocarcinomas and human breast cancer cell lines.Cancer Res. 2003 May 1;63(9):2179-87.
• [4] Multiplex methylated DNA testing in plasma with high sensitivity and specificity for colorectal cancer screening.Cancer Med. 2019 Sep;8(12):5619-5628. doi: 10.1002/cam4.2475. Epub 2019 Aug 12.
• [5] Mutations in SEPT9 cause hereditary neuralgic amyotrophy. Nat Genet. 2005 Oct;37(10):1044-6. doi: 10.1038/ng1649. Epub 2005 Sep 25.
• [6] SEPT9_i1 regulates human breast cancer cell motility through cytoskeletal and RhoA/FAK signaling pathway regulation.Cell Death Dis. 2019 Sep 26;10(10):720. doi: 10.1038/s41419-019-1947-9.
• [7] Septin 9 isoform expression, localization and epigenetic changes during human and mouse breast cancer progression.Breast Cancer Res. 2011 Aug 10;13(4):R76. doi: 10.1186/bcr2924.
• [8] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [9] Promoter methylation of SEPT9 as a potential biomarker for early detection of cervical cancer and its overexpression predicts radioresistance.Clin Epigenetics. 2019 Aug 19;11(1):120. doi: 10.1186/s13148-019-0719-9.
• [10] Detection of methylated SEPT9 in plasma is a reliable screening method for both left- and right-sided colon cancers.PLoS One. 2012;7(9):e46000. doi: 10.1371/journal.pone.0046000. Epub 2012 Sep 25.
• [11] Sensitive detection of colorectal cancer in peripheral blood by septin 9 DNA methylation assay.PLoS One. 2008;3(11):e3759. doi: 10.1371/journal.pone.0003759. Epub 2008 Nov 19.
• [12] Study on early diagnosis of epithelial ovarian cancer by analysis of plasma septin-9 and clusterin level.J Cancer Res Ther. 2018 Jun;14(Supplement):S444-S449. doi: 10.4103/0973-1482.181178.
• [13] Genome-wide screening of DNA methylation associated with lymph node metastasis in esophageal squamous cell carcinoma.Oncotarget. 2017 Jun 6;8(23):37740-37750. doi: 10.18632/oncotarget.17147.
• [14] Repression of Septin9 and Septin2 suppresses tumor growth of human glioblastoma cells.Cell Death Dis. 2018 May 1;9(5):514. doi: 10.1038/s41419-018-0547-4.
• [15] An MLL-SEPT9 fusion and t(11;17)(q23;q25) associated with de novo myelodysplastic syndrome.Leuk Res. 2007 Aug;31(8):1145-8. doi: 10.1016/j.leukres.2006.12.006. Epub 2007 Jan 23.
• [16] Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
• [17] Genome wide DNA differential methylation regions in colorectal cancer patients in relation to blood related family members, obese and non-obese controls - a preliminary report. Oncotarget. 2018 May 22;9(39):25557-25571.
• [18] Altered patterns of transcription of the septin gene, SEPT9, in ovarian tumorigenesis.Int J Cancer. 2006 Mar 1;118(5):1325-9. doi: 10.1002/ijc.21486.
• [19] Septin 9 amplification and isoform-specific expression in peritumoral and tumor breast tissue.Biol Chem. 2014 Feb;395(2):157-67. doi: 10.1515/hsz-2013-0247.
• [20] Non-recurrent SEPT9 duplications cause hereditary neuralgic amyotrophy.J Med Genet. 2010 Sep;47(9):601-7. doi: 10.1136/jmg.2009.072348. Epub 2009 Nov 25.
• [21] Diagnostic Assessment of septin9 DNA Methylation for Colorectal Cancer Using Blood Detection: A Meta-Analysis.Pathol Oncol Res. 2019 Oct;25(4):1525-1534. doi: 10.1007/s12253-018-0559-5. Epub 2018 Nov 28.
• [22] Septin 9 isoform 1 (SEPT9_i1) specifically interacts with importin-7 to drive hypoxia-inducible factor (HIF)-1 nuclear translocation.Cytoskeleton (Hoboken). 2019 Jan;76(1):123-130. doi: 10.1002/cm.21450. Epub 2018 Aug 24.
• [23] Identification of a novel amplicon at distal 17q containing the BIRC5/SURVIVIN gene in malignant peripheral nerve sheath tumours.J Pathol. 2006 Aug;209(4):492-500. doi: 10.1002/path.1998.
• [24] Potential of quantitative SEPT9 and SHOX2 methylation in plasmatic circulating cell-free DNA as auxiliary staging parameter in colorectal cancer: a prospective observational cohort study.Br J Cancer. 2018 May;118(9):1217-1228. doi: 10.1038/s41416-018-0035-8. Epub 2018 Apr 3.
• [25] Steps solidifying a role for SEPT9 in breast cancer suggest that greater strides are needed.Breast Cancer Res. 2012 Jan 9;14(1):101. doi: 10.1186/bcr3056.
• [26] Septin 9 promoter region methylation in free circulating DNA-potential role in noninvasive diagnosis of lung cancer: preliminary report.Med Oncol. 2014 Apr;31(4):917. doi: 10.1007/s12032-014-0917-4. Epub 2014 Mar 16.
• [27] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [28] The study of the relation of DNA repair pathway genes SNPs and the sensitivity to radiotherapy and chemotherapy of NSCLC.Sci Rep. 2016 Jun 1;6:26526. doi: 10.1038/srep26526.
• [29] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [30] Performance of the colorectal cancer screening marker Sept9 is influenced by age, diabetes and arthritis: a nested case-control study.BMC Cancer. 2015 Oct 29;15:819. doi: 10.1186/s12885-015-1832-6.
• [31] Simultaneous Analysis of SEPT9 Promoter Methylation Status, Micronuclei Frequency, and Folate-Related Gene Polymorphisms: The Potential for a Novel Blood-Based Colorectal Cancer Biomarker.Int J Mol Sci. 2015 Dec 1;16(12):28486-97. doi: 10.3390/ijms161226113.
• [32] The SEPT9 gene methylation assay is capable of detecting colorectal adenoma in opportunistic screening.Epigenomics. 2017 May;9(5):599-610. doi: 10.2217/epi-2016-0146. Epub 2017 May 4.
• [33] Plasma mSEPT9: A Novel Circulating Cell-free DNA-Based Epigenetic Biomarker to Diagnose Hepatocellular Carcinoma.EBioMedicine. 2018 Apr;30:138-147. doi: 10.1016/j.ebiom.2018.03.029. Epub 2018 Mar 28.
• [34] Haemoglobinopathies and the clinical epidemiology of malaria: a systematic review and meta-analysis.Lancet Infect Dis. 2012 Jun;12(6):457-68. doi: 10.1016/S1473-3099(12)70055-5. Epub 2012 Mar 23.
• [35] Conquering the complex world of human septins: implications for health and disease.Clin Genet. 2010 Jun;77(6):511-24. doi: 10.1111/j.1399-0004.2010.01392.x. Epub 2010 Feb 11.
• [36] Integrated analysis of genome-wide DNA methylation and gene expression profiles identifies potential novel biomarkers of rectal cancer.Oncotarget. 2016 Sep 20;7(38):62547-62558. doi: 10.18632/oncotarget.11534.
• [37] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [38] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [43] Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
• [44] Benzo[a]pyrene treatment leads to changes in nuclear protein expression and alternative splicing. Mutat Res. 2010 Apr 1;686(1-2):47-56. doi: 10.1016/j.mrfmmm.2010.01.015. Epub 2010 Jan 25.
• [45] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [46] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [47] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [48] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [49] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [50] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.