General Information of Drug Off-Target (DOT) (ID: OT3MW415)

DOT Name Ankyrin repeat domain-containing protein 36B (ANKRD36B)
Synonyms CLL-associated antigen KW-1
Gene Name ANKRD36B
Related Disease
Melanoma ( )
Adenocarcinoma ( )
Adult glioblastoma ( )
Advanced cancer ( )
Bladder cancer ( )
Carcinoma of esophagus ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Esophageal cancer ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Head-neck squamous cell carcinoma ( )
Immunodeficiency ( )
Laryngeal carcinoma ( )
Laryngeal disorder ( )
Laryngeal squamous cell carcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm of esophagus ( )
Sarcoma ( )
Soft tissue sarcoma ( )
Squamous cell carcinoma ( )
Testicular cancer ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Transitional cell carcinoma ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Urothelial carcinoma ( )
Carcinoma ( )
Pancreatic cancer ( )
Prader-Willi syndrome ( )
Synovial sarcoma ( )
Triple negative breast cancer ( )
Uveal Melanoma ( )
Breast cancer ( )
Breast carcinoma ( )
Cutaneous squamous cell carcinoma ( )
Stomach cancer ( )
Thyroid gland papillary carcinoma ( )
UniProt ID
AN36B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12796 ; PF14915
Sequence
MERLCSDGFAFPHYYIKPYHLKRIHRAVLRGNLEKLKYLLLTYYDANKRDRKERTALHLA
CATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGR
TALHYAVYNEDTSMIEKLLSHGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNA
IDYLGRSALILAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEAENRVIFDLIYEY
KRKRYEDLPINSNPVSPQKQRAEKATSDDKDSVSNIATEIKEGPISGTVSSQKQPAEKAT
SDEKDSVSNIATEIKEGQQSGTVSPQKQSAQKVIFKKKVSLLNIATRIMGGGKSGTVSSQ
KQPASKTASDKTDSALNTATEIKDGLQCGTVSSQKQQALKATTDEEGSVSNIATEIKDGE
KSGTVSSQKKPALKATSDEKDSFSNITREKKDGEISRTVSSQKPPALKATSVKEDSVLNI
AREKKDGEKSRTVSFEQPPGLKATRDEKDSLLNIARGKKDGEKTRRVSSHKQPSLKATSD
KEDSVPNMATETKDEQISGTVSCQKQPALKATSDKKDSVSNIPTEIKDGQQSGTVSSQKQ
PAWKATSVKKDSVSNIATEIKDGQIRGTVSSQRRPALKTTGDEKDSVSNIAREIKDGEKS
GTVSPQKQSAQKVIFKKKVSLLNIATRITGGGKSGTEYPENLRTLKATIENKDSVLNTAT
KMKEVQTSTPAEQDLEMASEGEQKRLEEYENNQPQVKNQIHSRDDLDDIIQSSQTVSEDG
DSLCCNCKNVILLIDQHEMKCKDCVHLLKIKNTFCLWKRLIKLKDNHCEQLRVKIRKLKN
KASVLQKRISEKEEIKSQLKHEILELEKELCSLRFAIQQEKKKRRNVEELHQKVREKLRI
TEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSETDEKEDLLHENRLMQDEIARLR
LEKDTIKNQNLEKKYLKDFEIVKRKHEDLQKALKRNGETLAKTIACYSGQLAALTDENTT
LRSKLEKQRESRQRLETEMQSYRCRLNAARCDHDQSHSSKRDQELAFQGTVDKCRHLQEN
LNSHVLILSLQLSKAESKSRVLKTELHYTGEALKEKALVFEHVQSELKQKQSQMKDIEKM
YKSGYNTMEKCIEKQERFCQLKKQNMLLQQQLDDARNKADNQEKAILNIQARCDARVQNL
QAECRKHRLLLEEDNKMLVNELNHSKEKECQYEKEKAEREVAVRQLQQKRDDVLNKGSAT
KALLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGDTQKLEVEH
VMMRKIIKKQDDQIERLEKILQHSSLMLQVFES

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Definitive Biomarker [1]
Adenocarcinoma DIS3IHTY Strong Genetic Variation [2]
Adult glioblastoma DISVP4LU Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Bladder cancer DISUHNM0 Strong Altered Expression [5]
Carcinoma of esophagus DISS6G4D Strong Altered Expression [6]
Colon cancer DISVC52G Strong Altered Expression [7]
Colon carcinoma DISJYKUO Strong Altered Expression [7]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [8]
Esophageal cancer DISGB2VN Strong Altered Expression [6]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [9]
Gastric cancer DISXGOUK Strong Altered Expression [10]
Glioblastoma multiforme DISK8246 Strong Biomarker [3]
Glioma DIS5RPEH Strong Altered Expression [11]
Head and neck cancer DISBPSQZ Strong Biomarker [12]
Head and neck carcinoma DISOU1DS Strong Biomarker [12]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [13]
Immunodeficiency DIS093I0 Strong Altered Expression [14]
Laryngeal carcinoma DISNHCIV Strong Altered Expression [15]
Laryngeal disorder DISDKUQO Strong Altered Expression [13]
Laryngeal squamous cell carcinoma DIS9UUVF Strong Biomarker [16]
Lung cancer DISCM4YA Strong Altered Expression [17]
Lung carcinoma DISTR26C Strong Altered Expression [17]
Neoplasm of esophagus DISOLKAQ Strong Altered Expression [6]
Sarcoma DISZDG3U Strong Biomarker [18]
Soft tissue sarcoma DISSN8XB Strong Biomarker [18]
Squamous cell carcinoma DISQVIFL Strong Genetic Variation [2]
Testicular cancer DIS6HNYO Strong Altered Expression [18]
Thyroid cancer DIS3VLDH Strong Biomarker [19]
Thyroid gland carcinoma DISMNGZ0 Strong Biomarker [19]
Thyroid tumor DISLVKMD Strong Biomarker [19]
Transitional cell carcinoma DISWVVDR Strong Biomarker [20]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [5]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [5]
Urothelial carcinoma DISRTNTN Strong Biomarker [20]
Carcinoma DISH9F1N moderate Altered Expression [21]
Pancreatic cancer DISJC981 moderate Altered Expression [22]
Prader-Willi syndrome DISYWMLU moderate Genetic Variation [23]
Synovial sarcoma DISEZJS7 moderate Biomarker [18]
Triple negative breast cancer DISAMG6N moderate Altered Expression [24]
Uveal Melanoma DISA7ZGL moderate Biomarker [25]
Breast cancer DIS7DPX1 Limited Biomarker [26]
Breast carcinoma DIS2UE88 Limited Biomarker [26]
Cutaneous squamous cell carcinoma DIS3LXUG Limited Biomarker [27]
Stomach cancer DISKIJSX Limited Altered Expression [10]
Thyroid gland papillary carcinoma DIS48YMM Limited Altered Expression [28]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [29]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [31]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [32]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [33]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [34]
Fluorouracil DMUM7HZ Approved Fluorouracil affects the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [35]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [36]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [37]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [29]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [38]
crotylaldehyde DMTWRQI Investigative crotylaldehyde decreases the expression of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the methylation of Ankyrin repeat domain-containing protein 36B (ANKRD36B). [30]
------------------------------------------------------------------------------------

References

1 Recombinant DNA technology for melanoma immunotherapy: anti-Id DNA vaccines targeting high molecular weight melanoma-associated antigen.Mol Biotechnol. 2014 Nov;56(11):1032-9. doi: 10.1007/s12033-014-9782-9.
2 Gene expression of MAGE-A3 and PRAME tumor antigens and EGFR mutational status in Taiwanese non-small cell lung cancer patients.Asia Pac J Clin Oncol. 2017 Oct;13(5):e212-e223. doi: 10.1111/ajco.12586. Epub 2016 Aug 12.
3 A DNA vaccine expressing tyrosinase-related protein-2 induces T-cell-mediated protection against mouse glioblastoma.Cancer Gene Ther. 2003 Sep;10(9):678-88. doi: 10.1038/sj.cgt.7700620.
4 Cancer-testis antigens MAGEA proteins are incorporated into extracellular vesicles released by cells.Oncotarget. 2019 Jun 4;10(38):3694-3708. doi: 10.18632/oncotarget.26979. eCollection 2019 Jun 4.
5 Multitarget fluorescence in situ hybridization and melanoma antigen genes analysis in primary bladder carcinoma.Cancer Genet Cytogenet. 2006 Jan 1;164(1):32-8. doi: 10.1016/j.cancergencyto.2005.06.006.
6 Demethylation-mediated upregulation of melanoma-associated antigen-A11 correlates with malignant progression of esophageal squamous cell carcinoma.Dig Liver Dis. 2019 Oct;51(10):1475-1482. doi: 10.1016/j.dld.2019.04.018. Epub 2019 May 31.
7 The expression of MAGE and SSX, and correlation of COX2, VEGF, and survivin in colorectal cancer.Anticancer Res. 2012 Feb;32(2):559-64.
8 The Expression of Melanoma-Associated Antigen D2 Both in Surgically Resected and Serum Samples Serves as Clinically Relevant Biomarker of Gastric Cancer Progression.Ann Surg Oncol. 2016 Feb;23 Suppl 2:S214-21. doi: 10.1245/s10434-015-4457-8. Epub 2015 Mar 6.
9 Expression, Function, and Prognostic Value of MAGE-D4 Protein in Esophageal Squamous Cell Carcinoma.Anticancer Res. 2019 Nov;39(11):6015-6023. doi: 10.21873/anticanres.13807.
10 Tissue Expression of Melanoma-associated Antigen A6 and Clinical Characteristics of Gastric Cancer.Anticancer Res. 2019 Nov;39(11):5903-5910. doi: 10.21873/anticanres.13794.
11 Melanoma-associated antigen A2 is overexpressed in glioma and associated with poor prognosis in glioma patients.Neoplasma. 2018;65(4):604-609. doi: 10.4149/neo_2018_170625N440.
12 Melanoma-associated antigen A11 reduces erlotinib and afatinib efficacy in head and neck cancer.J Craniomaxillofac Surg. 2018 Mar;46(3):492-497. doi: 10.1016/j.jcms.2017.12.014. Epub 2017 Dec 24.
13 Clinical significance of melanoma-associated antigen A1-6 expression in sputum of patients with squamous cell carcinoma of the larynx and hypopharynx.Head Neck. 2016 Apr;38 Suppl 1:E736-40. doi: 10.1002/hed.24081. Epub 2015 Jul 18.
14 T-cell receptor gene therapy targeting melanoma-associated antigen-A4 inhibits human tumor growth in non-obese diabetic/SCID/cnull mice.Cancer Sci. 2012 Jan;103(1):17-25. doi: 10.1111/j.1349-7006.2011.02111.x. Epub 2011 Nov 8.
15 Expression and prognostic value of MAGE-A9 in laryngeal squamous cell carcinoma.Int J Clin Exp Pathol. 2014 Sep 15;7(10):6734-42. eCollection 2014.
16 MiR-143-3p suppresses cell proliferation, migration, and invasion by targeting Melanoma-Associated Antigen A9 in laryngeal squamous cell carcinoma.J Cell Biochem. 2019 Feb;120(2):1245-1257. doi: 10.1002/jcb.27084. Epub 2018 Oct 9.
17 Association of MAGE A1-6 Expression with Lung Cancer Progression.J Cancer. 2017 May 12;8(8):1324-1329. doi: 10.7150/jca.18086. eCollection 2017.
18 Immunohistochemical expression and clinicopathological assessment of the cancer testis antigens NY-ESO-1 and MAGE-A4 in high-grade soft-tissue sarcoma.Oncol Lett. 2019 Apr;17(4):3937-3943. doi: 10.3892/ol.2019.10044. Epub 2019 Feb 14.
19 The cancer/testis antigen melanoma-associated antigen-A3/A6 is a novel target of fibroblast growth factor receptor 2-IIIb through histone H3 modifications in thyroid cancer.Clin Cancer Res. 2007 Aug 15;13(16):4713-20. doi: 10.1158/1078-0432.CCR-07-0618.
20 Melanoma-associated antigen-A and programmed death-ligand 1 expression are associated with advanced urothelial carcinoma.Cancer Immunol Immunother. 2019 May;68(5):743-751. doi: 10.1007/s00262-019-02316-w. Epub 2019 Feb 21.
21 Clinical application of MAGE A1-6 RT-nested PCR for diagnosis of lung cancer invisible by bronchoscopy.Anticancer Res. 2012 Jan;32(1):163-7.
22 Functional and mechanistic studies reveal MAGEA3 as a pro-survival factor in pancreatic cancer cells.J Exp Clin Cancer Res. 2019 Jul 8;38(1):294. doi: 10.1186/s13046-019-1272-2.
23 Necdin protects embryonic motoneurons from programmed cell death.PLoS One. 2011;6(9):e23764. doi: 10.1371/journal.pone.0023764. Epub 2011 Sep 2.
24 hMAGEA2 promotes progression of breast cancer by regulating Akt and Erk1/2 pathways.Oncotarget. 2017 Jun 6;8(23):37115-37127. doi: 10.18632/oncotarget.16184.
25 An ocular melanoma-associated antigen. Molecular characterization.Arch Ophthalmol. 1992 Mar;110(3):399-404. doi: 10.1001/archopht.1992.01080150097036.
26 Prognostic roles of MAGE family members in breast cancer based on KM-Plotter Data.Oncol Lett. 2019 Oct;18(4):3501-3516. doi: 10.3892/ol.2019.10722. Epub 2019 Aug 6.
27 Overexpression and Implications of Melanoma-associated Antigen A12 in Pathogenesis of Human Cutaneous Squamous Cell Carcinoma.Anticancer Res. 2019 Apr;39(4):1849-1857. doi: 10.21873/anticanres.13292.
28 Expression of MAGE A1-6 and the clinical characteristics of papillary thyroid carcinoma.Anticancer Res. 2013 Apr;33(4):1731-5.
29 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
30 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
31 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
32 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
33 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
34 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
35 Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
36 Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
37 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
38 An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
39 Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.