Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5FH4BD)

DOT Name Muellerian-inhibiting factor (AMH)
Synonyms Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS
Gene Name AMH
Related Disease
Androgen insensitivity syndrome ( )
Hypogonadism ( )
Rheumatoid arthritis ( )
Adult glioblastoma ( )
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Cervical cancer ( )
Cervical carcinoma ( )
Classic galactosemia ( )
Depression ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Endometriosis ( )
Glioblastoma multiforme ( )
High blood pressure ( )
Hypogonadism, male ( )
Malignant neoplasm ( )
Neoplasm ( )
Obesity ( )
Ovarian hyperstimulation syndrome ( )
Persistent Mullerian duct syndrome ( )
Precocious puberty ( )
Systemic lupus erythematosus ( )
Trichohepatoenteric syndrome ( )
Type-1/2 diabetes ( )
Wilms tumor ( )
Chronic kidney disease ( )
Disorder of sexual differentiation ( )
Gonadal dysgenesis ( )
Adult lymphoma ( )
Central precocious puberty ( )
Cryptorchidism ( )
Granulosa cell tumor ( )
Klinefelter syndrome ( )
Lymphoma ( )
Non-insulin dependent diabetes ( )
Osteoporosis ( )
Pediatric lymphoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Turner syndrome ( )
UniProt ID
MIS_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7L0J
Pfam ID
PF04709 ; PF00019
Sequence
MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALG
GDSNGSSSPLRVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGA
WLRDPGGQRLVVLHLEEVTWEPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAG
LPGAQSLCPSRDTRYLVLAVDRPAGAWRGSGLALTLQPRGEDSRLSTARLQALLFGDDHR
CFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRA
LRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDP
APLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD
PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIP
ETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLS
EERISAHHVPNMVATECGCR
Function
Plays an important role in several reproductive functions. Induces Muellerian duct regression during male fetal sexual differentiation. Also plays a role in Leydig cell differentiation and function. In female acts as a negative regulator of the primordial to primary follicle transition and decreases FSH sensitivity of growing follicles. AMH signals by binding to a specific type-II receptor, AMHR2, that heterodimerizes with type-I receptors (ACVR1 and BMPR1A), and recruiting SMAD proteins that are translocated to the nucleus to regulate target gene expression.
Tissue Specificity In ovaries, AMH is detected in granulosa cells of early growing follicles.
KEGG Pathway
cAMP sig.ling pathway (hsa04024 )
Cytokine-cytokine receptor interaction (hsa04060 )
TGF-beta sig.ling pathway (hsa04350 )
Hippo sig.ling pathway (hsa04390 )
Reactome Pathway
Transcriptional regulation of testis differentiation (R-HSA-9690406 )
Signaling by BMP (R-HSA-201451 )

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Androgen insensitivity syndrome DISUZBBO Definitive Genetic Variation [1]
Hypogonadism DISICMNI Definitive Biomarker [2]
Rheumatoid arthritis DISTSB4J Definitive Biomarker [3]
Adult glioblastoma DISVP4LU Strong Biomarker [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Breast cancer DIS7DPX1 Strong Altered Expression [6]
Breast carcinoma DIS2UE88 Strong Altered Expression [6]
Cervical cancer DISFSHPF Strong Biomarker [7]
Cervical carcinoma DIST4S00 Strong Biomarker [7]
Classic galactosemia DISX7P8M Strong Biomarker [8]
Depression DIS3XJ69 Strong Biomarker [9]
Endometrial cancer DISW0LMR Strong Biomarker [10]
Endometrial carcinoma DISXR5CY Strong Biomarker [10]
Endometriosis DISX1AG8 Strong Biomarker [11]
Glioblastoma multiforme DISK8246 Strong Biomarker [4]
High blood pressure DISY2OHH Strong Genetic Variation [12]
Hypogonadism, male DISV1F5R Strong Biomarker [2]
Malignant neoplasm DISS6SNG Strong Biomarker [13]
Neoplasm DISZKGEW Strong Biomarker [14]
Obesity DIS47Y1K Strong Altered Expression [15]
Ovarian hyperstimulation syndrome DIS4L94Y Strong Altered Expression [16]
Persistent Mullerian duct syndrome DISJ491E Strong Autosomal recessive [17]
Precocious puberty DISYI2XZ Strong Biomarker [18]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [19]
Trichohepatoenteric syndrome DISL3ODF Strong Altered Expression [20]
Type-1/2 diabetes DISIUHAP Strong Biomarker [21]
Wilms tumor DISB6T16 Strong Altered Expression [22]
Chronic kidney disease DISW82R7 moderate Altered Expression [23]
Disorder of sexual differentiation DISRMAEZ Disputed Altered Expression [24]
Gonadal dysgenesis DISIL2ZI Disputed Genetic Variation [25]
Adult lymphoma DISK8IZR Limited Biomarker [26]
Central precocious puberty DISW1TFK Limited Altered Expression [27]
Cryptorchidism DISYUD2P Limited Genetic Variation [28]
Granulosa cell tumor DISKWVAB Limited Biomarker [29]
Klinefelter syndrome DISOUI7W Limited Altered Expression [24]
Lymphoma DISN6V4S Limited Biomarker [26]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [21]
Osteoporosis DISF2JE0 Limited Genetic Variation [30]
Pediatric lymphoma DIS51BK2 Limited Biomarker [26]
Prostate cancer DISF190Y Limited Biomarker [31]
Prostate carcinoma DISMJPLE Limited Biomarker [31]
Turner syndrome DIS2035C Limited Altered Expression [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 42 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Muellerian-inhibiting factor (AMH). [33]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Muellerian-inhibiting factor (AMH). [41]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Muellerian-inhibiting factor (AMH). [34]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Muellerian-inhibiting factor (AMH). [35]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Muellerian-inhibiting factor (AMH). [36]
Carbamazepine DMZOLBI Approved Carbamazepine decreases the expression of Muellerian-inhibiting factor (AMH). [37]
Decitabine DMQL8XJ Approved Decitabine decreases the expression of Muellerian-inhibiting factor (AMH). [38]
Marinol DM70IK5 Approved Marinol increases the expression of Muellerian-inhibiting factor (AMH). [39]
DTI-015 DMXZRW0 Approved DTI-015 decreases the expression of Muellerian-inhibiting factor (AMH). [40]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Muellerian-inhibiting factor (AMH). [42]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Muellerian-inhibiting factor (AMH). [43]
Phencyclidine DMQBEYX Investigative Phencyclidine decreases the expression of Muellerian-inhibiting factor (AMH). [44]
AHPN DM8G6O4 Investigative AHPN decreases the expression of Muellerian-inhibiting factor (AMH). [45]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Safety and effectiveness of minimally invasive scoliosis surgery for adolescent idiopathic scoliosis: a retrospective case series of 84 patients.Eur Spine J. 2020 Apr;29(4):761-769. doi: 10.1007/s00586-019-06172-1. Epub 2019 Oct 21.
2 Correlation of anti-Mullerian hormone with humanchorionic gonadotropin test in the evaluation of testicular function of children with 46 XY male hypogonadism: Use of anti-Mullerian hormone as abiomarker.J Paediatr Child Health. 2020 Mar;56(3):411-419. doi: 10.1111/jpc.14643. Epub 2019 Oct 15.
3 Fertility and Ovarian Reserve among Women with Rheumatoid Arthritis.J Rheumatol. 2019 May;46(5):455-459. doi: 10.3899/jrheum.180176. Epub 2018 Nov 15.
4 Potent synergy of dual antitumor peptides for growth suppression of human glioblastoma cell lines.Mol Cancer Ther. 2008 Jun;7(6):1461-71. doi: 10.1158/1535-7163.MCT-07-2010.
5 Changes in Anti-Mllerian Hormone and Inhibin B in Children Treated for Cancer.J Adolesc Young Adult Oncol. 2019 Jun;8(3):281-290. doi: 10.1089/jayao.2018.0130. Epub 2019 Jan 31.
6 Association of BRCA Mutations and Anti-mllerian Hormone Level in Young Breast Cancer Patients.Front Endocrinol (Lausanne). 2019 Apr 11;10:235. doi: 10.3389/fendo.2019.00235. eCollection 2019.
7 Expression of Mllerian inhibiting substance type II receptor and antiproliferative effects of MIS on human cervical cancer.Int J Oncol. 2012 Jun;40(6):2013-21. doi: 10.3892/ijo.2012.1370. Epub 2012 Feb 14.
8 Presentation, progression, and predictors of ovarian insufficiency in classic galactosemia.J Inherit Metab Dis. 2018 Sep;41(5):785-790. doi: 10.1007/s10545-018-0177-0. Epub 2018 May 2.
9 PHQ-9 Score Predicts Postoperative Outcomes Following Minimally Invasive Transforaminal Lumbar Interbody Fusion.Clin Spine Surg. 2019 Dec;32(10):444-448. doi: 10.1097/BSD.0000000000000818.
10 Anti-Mllerian Hormone Expression in Endometrial Cancer Tissue.Int J Mol Sci. 2019 Mar 15;20(6):1325. doi: 10.3390/ijms20061325.
11 Effect of laparoscopic endometrioma cystectomy on anti-Mllerian hormone (AMH) levels.Gynecol Endocrinol. 2019 Jun;35(6):494-497. doi: 10.1080/09513590.2018.1549220. Epub 2019 Feb 7.
12 Serum anti mullerian hormone and renalase levels in predicting the risk of preeclampsia.Taiwan J Obstet Gynecol. 2019 Mar;58(2):188-191. doi: 10.1016/j.tjog.2019.01.003.
13 Early Detection of Ovarian Dysfunction by Anti-Mullerian Hormone in Adolescent and Young Adult-Aged Survivors of Childhood Cancer.J Adolesc Young Adult Oncol. 2019 Feb;8(1):18-25. doi: 10.1089/jayao.2018.0080. Epub 2018 Oct 3.
14 Mllerian inhibiting substance/anti-Mllerian hormone type II receptor protein and mRNA expression in the healthy and cancerous endometria.Oncol Lett. 2019 Jan;17(1):532-538. doi: 10.3892/ol.2018.9565. Epub 2018 Oct 10.
15 Distinctive Reproductive Phenotypes in Peripubertal Girls at Risk for Polycystic Ovary Syndrome.J Clin Endocrinol Metab. 2019 Aug 1;104(8):3355-3361. doi: 10.1210/jc.2018-02313.
16 Intrafollicular melatonin concentration is elevated in patients with ovarian hyperstimulation syndrome (OHSS) and can serve as an important predictor of OHSS.Arch Gynecol Obstet. 2019 Apr;299(4):1151-1158. doi: 10.1007/s00404-018-4994-z. Epub 2019 Feb 6.
17 Variants of the anti-Mllerian hormone gene in a compound heterozygote with the persistent Mllerian duct syndrome and his family. Hum Genet. 1992 Dec;90(4):389-94. doi: 10.1007/BF00220465.
18 Androgens downregulate anti-Mllerian hormone promoter activity in the Sertoli cell through the androgen receptor and intact steroidogenic factor 1 sites.Biol Reprod. 2018 Dec 1;99(6):1303-1312. doi: 10.1093/biolre/ioy152.
19 Anti-Mllerian hormone serum levels in systemic lupus erythematosus patients: Influence of the disease severity and therapy on the ovarian reserve.Endocrine. 2019 Feb;63(2):369-375. doi: 10.1007/s12020-018-1783-1. Epub 2018 Oct 15.
20 Levels of anti-Mllerian hormone in premenopausal women with the antiphospholipid syndrome and its association with the risk of clinical complications.Lupus. 2019 Mar;28(3):427-431. doi: 10.1177/0961203319828507. Epub 2019 Feb 4.
21 Anti-Mllerian hormone in type 2 and gestational diabetes during the second half of pregnancy: relationship with sexual steroid levels and metabolic parameters.Gynecol Endocrinol. 2018 Feb;34(2):120-124. doi: 10.1080/09513590.2017.1359824. Epub 2017 Jul 31.
22 Role of Wilms tumor 1 (WT1) in the transcriptional regulation of the Mullerian-inhibiting substance promoter.Biol Reprod. 2003 Dec;69(6):1808-14. doi: 10.1095/biolreprod.103.015826. Epub 2003 Jul 9.
23 Circulating 25-hydroxy vitamin D correlates with serum level of anti-Mllerian hormone in male patients with chronic kidney disease.Andrologia. 2018 Feb 14. doi: 10.1111/and.12972. Online ahead of print.
24 Regulation of anti-Mllerian hormone (AMH) in males and the associations of serum AMH with the disorders of male fertility.Asian J Androl. 2019 Mar-Apr;21(2):109-114. doi: 10.4103/aja.aja_83_18.
25 Update--steroidogenic factor 1 (SF-1, NR5A1).Minerva Endocrinol. 2010 Jun;35(2):73-86.
26 Five-year study assessing the clinical utility of anti-Mllerian hormone measurements in reproductive-age women with cancer.Reprod Biomed Online. 2019 Oct;39(4):712-720. doi: 10.1016/j.rbmo.2019.06.001. Epub 2019 Jun 11.
27 AMH levels in girls with various pubertal problems.J Pediatr Endocrinol Metab. 2017 Mar 1;30(3):333-335. doi: 10.1515/jpem-2016-0217.
28 AMH and AMHR2 mutations: A spectrum of reproductive phenotypes across vertebrate species.Dev Biol. 2019 Nov 1;455(1):1-9. doi: 10.1016/j.ydbio.2019.07.006. Epub 2019 Jul 10.
29 Anti Mllerian Hormone: More than a biomarker of female reproductive function.J Gynecol Obstet Hum Reprod. 2019 Jan;48(1):19-24. doi: 10.1016/j.jogoh.2018.10.015. Epub 2018 Oct 22.
30 Comparison of the fenestrated pedicle screw and conventional pedicle screw in minimally percutaneous fixation for the treatment of spondylolisthesis with osteoporotic spine.Clin Neurol Neurosurg. 2019 Aug;183:105377. doi: 10.1016/j.clineuro.2019.105377. Epub 2019 May 23.
31 Mllerian inhibiting substance type II receptor (MISIIR): a novel, tissue-specific target expressed by gynecologic cancers.Gynecol Oncol. 2008 Jan;108(1):141-8. doi: 10.1016/j.ygyno.2007.09.010. Epub 2007 Nov 7.
32 Anti-Mllerian hormone levels in patients with turner syndrome: Relation to karyotype, spontaneous puberty, and replacement therapy.Am J Med Genet A. 2018 Sep;176(9):1929-1934. doi: 10.1002/ajmg.a.40473. Epub 2018 Aug 8.
33 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
34 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
35 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
36 Gene alterations of ovarian cancer cells expressing estrogen receptors by estrogen and bisphenol a using microarray analysis. Lab Anim Res. 2011 Jun;27(2):99-107. doi: 10.5625/lar.2011.27.2.99. Epub 2011 Jun 22.
37 Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
38 DNA methylation inhibits p53-mediated survivin repression. Oncogene. 2009 May 14;28(19):2046-50. doi: 10.1038/onc.2009.62. Epub 2009 Apr 13.
39 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
40 Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
41 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
42 Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
43 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
44 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
45 ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.