Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6B22JB)

• DOT Name: Myosin regulatory light polypeptide 9 (MYL9)
• Synonyms: 20 kDa myosin light chain; LC20; MLC-2C; Myosin RLC; Myosin regulatory light chain 2, smooth muscle isoform; Myosin regulatory light chain 9; Myosin regulatory light chain MRLC1
• Gene Name: MYL9
• Related Disease:
  Bone osteosarcoma
  Cardiomyopathy
  Cerebral edema
  Clear cell renal carcinoma
  Endometriosis
  Esophageal squamous cell carcinoma
  Familial hypertrophic cardiomyopathy
  Glomerulonephritis
  Head and neck cancer
  Head and neck carcinoma
  Hypercholesterolemia, familial, 1
  Hypertrophic cardiomyopathy
  Lung cancer
  Lung carcinoma
  Malignant soft tissue neoplasm
  Megacystis-microcolon-intestinal hypoperistalsis syndrome 4
  Megalencephalic leukoencephalopathy with subcortical cysts
  Melanoma
  Myopathy
  Neoplasm
  Non-small-cell lung cancer
  Osteosarcoma
  Renal cell carcinoma
  Sarcoma
  Thrombocytopenia
  Vascular disease
  Colon cancer
  Colon carcinoma
  Megacystis-microcolon-intestinal hypoperistalsis syndrome
  Adult glioblastoma
  Glioblastoma multiforme
  Prostate cancer
  Prostate carcinoma
• UniProt ID: MYL9_HUMAN
• Pfam ID: PF13499
• Sequence:
  MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
  LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
  DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
• Function: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. In myoblasts, may regulate PIEZO1-dependent cortical actomyosin assembly involved in myotube formation.
• Tissue Specificity: Smooth muscle tissues and in some, but not all, nonmuscle cells.
• KEGG Pathway:
  cGMP-PKG sig.ling pathway (hsa04022)
  cAMP sig.ling pathway (hsa04024)
  Vascular smooth muscle contraction (hsa04270)
  Axon guidance (hsa04360)
  Focal adhesion (hsa04510)
  Adherens junction (hsa04520)
  Tight junction (hsa04530)
  Leukocyte transendothelial migration (hsa04670)
  Regulation of actin cytoskeleton (hsa04810)
  Motor proteins (hsa04814)
  Cytoskeleton in muscle cells (hsa04820)
  Oxytocin sig.ling pathway (hsa04921)
  Shigellosis (hsa05131)
  Salmonella infection (hsa05132)
• Reactome Pathway:
  Sema4D induced cell migration and growth-cone collapse (R-HSA-416572)
  Smooth Muscle Contraction (R-HSA-445355)
  RHO GTPases activate PKNs (R-HSA-5625740)
  RHO GTPases activate CIT (R-HSA-5625900)
  RHO GTPases Activate ROCKs (R-HSA-5627117)
  RHO GTPases activate PAKs (R-HSA-5627123)
  RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function (R-HSA-8936459)
  EPHA-mediated growth cone collapse (R-HSA-3928663)

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[1]
Cardiomyopathy	DISUPZRG	Strong	Genetic Variation	[2]
Cerebral edema	DIS4GHSB	Strong	Biomarker	[3]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[4]
Endometriosis	DISX1AG8	Strong	Genetic Variation	[5]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[6]
Familial hypertrophic cardiomyopathy	DISQ89HN	Strong	Posttranslational Modification	[7]
Glomerulonephritis	DISPZIQ3	Strong	Biomarker	[8]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[9]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[9]
Hypercholesterolemia, familial, 1	DISU411W	Strong	Genetic Variation	[2]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[10]
Lung cancer	DISCM4YA	Strong	Altered Expression	[11]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[11]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Altered Expression	[1]
Megacystis-microcolon-intestinal hypoperistalsis syndrome 4	DISEPQKJ	Strong	Autosomal recessive	[12]
Megalencephalic leukoencephalopathy with subcortical cysts	DISK9A1M	Strong	Genetic Variation	[13]
Melanoma	DIS1RRCY	Strong	Altered Expression	[14]
Myopathy	DISOWG27	Strong	Genetic Variation	[10]
Neoplasm	DISZKGEW	Strong	Altered Expression	[6]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[11]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[1]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[4]
Sarcoma	DISZDG3U	Strong	Altered Expression	[1]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[15]
Vascular disease	DISVS67S	Strong	Biomarker	[16]
Colon cancer	DISVC52G	moderate	Altered Expression	[17]
Colon carcinoma	DISJYKUO	moderate	Altered Expression	[17]
Megacystis-microcolon-intestinal hypoperistalsis syndrome	DIS9KV47	Disputed	Biomarker	[18]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[19]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[19]
Prostate cancer	DISF190Y	Limited	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[20]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Myosin regulatory light polypeptide 9 (MYL9) affects the response to substance of Fluorouracil.	[43]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[21]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[22]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[23]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[22]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[26]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[26]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[27]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Myosin regulatory light polypeptide 9 (MYL9).	[28]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[29]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[30]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[31]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[33]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[34]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[36]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[37]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN affects the expression of Myosin regulatory light polypeptide 9 (MYL9).	[38]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[39]
PD98059	DMZC90M	Investigative	PD98059 decreases the expression of Myosin regulatory light polypeptide 9 (MYL9).	[40]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Myosin regulatory light polypeptide 9 (MYL9).	[24]
LPA	DMI5XR1	Investigative	LPA increases the phosphorylation of Myosin regulatory light polypeptide 9 (MYL9).	[41]
RGD	DMFASRB	Investigative	RGD affects the phosphorylation of Myosin regulatory light polypeptide 9 (MYL9).	[42]

References

• [1] Human smooth muscle myosin light chain-2 gene expression is repressed in ras transformed fibroblast cells.Cell Growth Differ. 1992 Jan;3(1):1-10.
• [2] In vitro rescue study of a malignant familial hypertrophic cardiomyopathy phenotype by pseudo-phosphorylation of myosin regulatory light chain.Arch Biochem Biophys. 2014 Jun 15;552-553:29-39. doi: 10.1016/j.abb.2013.12.011. Epub 2013 Dec 26.
• [3] Inhibition of the myosin light chain kinase prevents hypoxia-induced blood-brain barrier disruption.J Neurochem. 2007 Jul;102(2):501-7. doi: 10.1111/j.1471-4159.2007.04506.x. Epub 2007 Apr 10.
• [4] Identification of novel VHL target genes and relationship to hypoxic response pathways.Oncogene. 2005 Jun 30;24(28):4549-58. doi: 10.1038/sj.onc.1208649.
• [5] Identification of biomarkers for endometriosis in eutopic endometrial cells from patients with endometriosis using a proteomics approach.Mol Med Rep. 2013 Jul;8(1):183-8. doi: 10.3892/mmr.2013.1469. Epub 2013 May 10.
• [6] Expression and prognostic significance of MYL9 in esophageal squamous cell carcinoma.PLoS One. 2017 Apr 7;12(4):e0175280. doi: 10.1371/journal.pone.0175280. eCollection 2017.
• [7] Therapeutic potential of AAV9-S15D-RLC gene delivery in humanized MYL2 mouse model of HCM.J Mol Med (Berl). 2019 Jul;97(7):1033-1047. doi: 10.1007/s00109-019-01791-z. Epub 2019 May 17.
• [8] Overexpression of interferon-activated gene 202 (Ifi202) correlates with the progression of autoimmune glomerulonephritis associated with the MRL chromosome 1.Lupus. 2010 Jul;19(8):897-905. doi: 10.1177/0961203310362534. Epub 2010 Feb 18.
• [9] Automatic replanning of VMAT plans for different treatment machines: Atemplate-based approach using constrained optimization.Strahlenther Onkol. 2018 Oct;194(10):921-928. doi: 10.1007/s00066-018-1319-x. Epub 2018 May 30.
• [10] Slow-twitch skeletal muscle defects accompany cardiac dysfunction in transgenic mice with a mutation in the myosin regulatory light chain.FASEB J. 2019 Mar;33(3):3152-3166. doi: 10.1096/fj.201801402R. Epub 2018 Oct 26.
• [11] MYLK and MYL9 expression in non-small cell lung cancer identified by bioinformatics analysis of public expression data.Tumour Biol. 2014 Dec;35(12):12189-200. doi: 10.1007/s13277-014-2527-3. Epub 2014 Sep 2.
• [12] Visceral myopathy: Clinical and molecular survey of a cohort of seven new patients and state of the art of overlapping phenotypes. Am J Med Genet A. 2016 Nov;170(11):2965-2974. doi: 10.1002/ajmg.a.37857. Epub 2016 Aug 2.
• [13] Leukoencephalopathy associated with 11q24 deletion involving the gene encoding hepatic and glial cell adhesion molecule in two patients.Eur J Med Genet. 2015 Sep;58(9):492-6. doi: 10.1016/j.ejmg.2015.06.008. Epub 2015 Jul 17.
• [14] Characterization of morphological changes of B16 melanoma cells under natural killer cell attack.Int Immunopharmacol. 2019 Feb;67:366-371. doi: 10.1016/j.intimp.2018.12.037. Epub 2018 Dec 21.
• [15] Regulation of platelet myosin light chain (MYL9) by RUNX1: implications for thrombocytopenia and platelet dysfunction in RUNX1 haplodeficiency.Blood. 2010 Dec 23;116(26):6037-45. doi: 10.1182/blood-2010-06-289850. Epub 2010 Sep 27.
• [16] Regulation of myosin light chain kinase expression by angiotensin II in hypertension.Am J Hypertens. 2008 Aug;21(8):860-5. doi: 10.1038/ajh.2008.199. Epub 2008 May 29.
• [17] Long non-coding RNA MBNL1-AS1 regulates proliferation, migration, and invasion of cancer stem cells in colon cancer by interacting with MYL9 via sponging microRNA-412-3p.Clin Res Hepatol Gastroenterol. 2020 Feb;44(1):101-114. doi: 10.1016/j.clinre.2019.05.001. Epub 2019 Jun 26.
• [18] Homozygous deletion in MYL9 expands the molecular basis of megacystis-microcolon-intestinal hypoperistalsis syndrome.Eur J Hum Genet. 2018 May;26(5):669-675. doi: 10.1038/s41431-017-0055-5. Epub 2018 Feb 16.
• [19] Expression pattern and prognostic significance of myosin light chain 9 (MYL9): a novel biomarker in glioblastoma.J Clin Pathol. 2019 Oct;72(10):677-681. doi: 10.1136/jclinpath-2019-205834. Epub 2019 Jul 3.
• [20] Decreased expression of myosin light chain MYL9 in stroma predicts malignant progression and poor biochemical recurrence-free survival in prostate cancer.Med Oncol. 2014 Jan;31(1):820. doi: 10.1007/s12032-013-0820-4. Epub 2013 Dec 14.
• [21] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [22] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [23] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [24] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [25] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [26] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [27] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [28] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [29] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [30] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [31] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [32] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [33] Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
• [34] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [35] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [36] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [37] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [38] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [39] Microcystin-leucine arginine exhibits adverse effects on human aortic vascular smooth muscle cells in vitro. Toxicol In Vitro. 2022 Oct;84:105450. doi: 10.1016/j.tiv.2022.105450. Epub 2022 Jul 26.
• [40] Myosin light-chain kinase contributes to the proliferation and migration of breast cancer cells through cross-talk with activated ERK1/2. Cancer Lett. 2008 Nov 8;270(2):312-27. doi: 10.1016/j.canlet.2008.05.028. Epub 2008 Aug 16.
• [41] Use of synthetic isoprenoids to target protein prenylation and Rho GTPases in breast cancer invasion. PLoS One. 2014 Feb 26;9(2):e89892. doi: 10.1371/journal.pone.0089892. eCollection 2014.
• [42] Amniogenesis in Human Amniotic Sac Embryoids after Exposures to Organophosphate Flame Retardants. Environ Health Perspect. 2023 Apr;131(4):47007. doi: 10.1289/EHP11958. Epub 2023 Apr 7.
• [43] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.