Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6QQ7OR)

• DOT Name: Glycerol-3-phosphate phosphatase (PGP)
• Synonyms: G3PP; EC 3.1.3.21; Aspartate-based ubiquitous Mg(2+)-dependent phosphatase; AUM; EC 3.1.3.48; Phosphoglycolate phosphatase; PGP
• Gene Name: PGP
• Related Disease:
  Acute myelogenous leukaemia
  Bipolar disorder
  Epithelial neoplasm
  Kidney neoplasm
  Acute lymphocytic leukaemia
  Advanced cancer
  Alzheimer disease
  Breast neoplasm
  Chorioamnionitis
  Chromosomal disorder
  Depression
  Hepatocellular carcinoma
  Hirschsprung disease
  Inflammatory bowel disease
  Intervertebral disc degeneration
  leukaemia
  Leukemia
  Lung cancer
  Metabolic disorder
  Neoplasm
  Neuralgia
  Parkinson disease
  Rhinitis
  Schizophrenia
  Squamous cell carcinoma
  Tardive dyskinesia
  Varicose veins
  Vitiligo
  Adenocarcinoma
  Methicillin-resistant staphylococci infection
  Myotonic dystrophy type 2
  Non-insulin dependent diabetes
  Nervous system disease
  Asthma
  Autosomal dominant polycystic kidney disease
  Colon adenocarcinoma
  Colorectal carcinoma
  Ewing sarcoma
  High blood pressure
  Lymphoid leukemia
  Lymphoma
  Neuroblastoma
  Rhabdomyosarcoma
  Type-1 diabetes
• UniProt ID: PGP_HUMAN
• EC Number: 3.1.3.21; 3.1.3.48
• Pfam ID: PF13344 ; PF13242
• Sequence:
  MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARG
  KRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPK
  AYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMK
  LTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFI
  FDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSK
  KKMVPDFYVDSIADLLPALQG
• Function: Glycerol-3-phosphate phosphatase hydrolyzing glycerol-3-phosphate into glycerol. Thereby, regulates the cellular levels of glycerol-3-phosphate a metabolic intermediate of glucose, lipid and energy metabolism. Was also shown to have a 2-phosphoglycolate phosphatase activity and a tyrosine-protein phosphatase activity. However, their physiological relevance is unclear. In vitro, has also a phosphatase activity toward ADP, ATP, GDP and GTP.
• Tissue Specificity: Detected in all tissues including red cells, lymphocytes and cultured fibroblasts (at protein level). The highest activities occur in skeletal muscle and cardiac muscle.
• KEGG Pathway:
  Glyoxylate and dicarboxylate metabolism (hsa00630)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
• Reactome Pathway: Glycolysis (R-HSA-70171)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Definitive	Biomarker	[1]
Bipolar disorder	DISAM7J2	Definitive	Biomarker	[2]
Epithelial neoplasm	DIS0T594	Definitive	Genetic Variation	[3]
Kidney neoplasm	DISBNZTN	Definitive	Genetic Variation	[3]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[7]
Chorioamnionitis	DISL1D9U	Strong	Biomarker	[8]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[9]
Depression	DIS3XJ69	Strong	Genetic Variation	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[11]
Hirschsprung disease	DISUUSM1	Strong	Biomarker	[12]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[13]
Intervertebral disc degeneration	DISG3AIM	Strong	Biomarker	[14]
leukaemia	DISS7D1V	Strong	Biomarker	[15]
Leukemia	DISNAKFL	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Altered Expression	[16]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Neuralgia	DISWO58J	Strong	Genetic Variation	[19]
Parkinson disease	DISQVHKL	Strong	Biomarker	[20]
Rhinitis	DISKLMN7	Strong	Genetic Variation	[21]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[22]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[23]
Tardive dyskinesia	DISKA5RC	Strong	Genetic Variation	[24]
Varicose veins	DISIMBN2	Strong	Biomarker	[25]
Vitiligo	DISR05SL	Strong	Altered Expression	[26]
Adenocarcinoma	DIS3IHTY	moderate	Altered Expression	[27]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Altered Expression	[28]
Myotonic dystrophy type 2	DIS5ZWF1	moderate	Genetic Variation	[29]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Genetic Variation	[29]
Nervous system disease	DISJ7GGT	Disputed	Biomarker	[30]
Asthma	DISW9QNS	Limited	Altered Expression	[31]
Autosomal dominant polycystic kidney disease	DISBHWUI	Limited	Biomarker	[32]
Colon adenocarcinoma	DISDRE0J	Limited	Biomarker	[33]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[34]
Ewing sarcoma	DISQYLV3	Limited	Altered Expression	[35]
High blood pressure	DISY2OHH	Limited	Biomarker	[36]
Lymphoid leukemia	DIS65TYQ	Limited	Altered Expression	[37]
Lymphoma	DISN6V4S	Limited	Altered Expression	[35]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[35]
Rhabdomyosarcoma	DISNR7MS	Limited	Altered Expression	[35]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[38]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Glycerol-3-phosphate phosphatase (PGP).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Glycerol-3-phosphate phosphatase (PGP).	[40]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Glycerol-3-phosphate phosphatase (PGP).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glycerol-3-phosphate phosphatase (PGP).	[42]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Glycerol-3-phosphate phosphatase (PGP).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Glycerol-3-phosphate phosphatase (PGP).	[45]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Glycerol-3-phosphate phosphatase (PGP).	[46]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Glycerol-3-phosphate phosphatase (PGP).	[43]

References

• [1] Fludarabine-based induction therapy does not overcome the negative effect of ABCG2 (BCRP) over-expression in adult acute myeloid leukemia patients.Leuk Res. 2010 Jul;34(7):942-5. doi: 10.1016/j.leukres.2010.01.008. Epub 2010 Jan 31.
• [2] A possible locus for manic depressive illness on chromosome 16p13.Psychiatr Genet. 1995 Summer;5(2):71-81. doi: 10.1097/00041444-199522000-00005.
• [3] Association of the P-glycoprotein transporter MDR1(C3435T) polymorphism with the susceptibility to renal epithelial tumors.J Am Soc Nephrol. 2002 Jul;13(7):1847-54. doi: 10.1097/01.asn.0000019412.87412.bc.
• [4] P-glycoprotein and BCL-2 levels predict outcome in adult acute lymphoblastic leukaemia.Br J Haematol. 2003 Jun;121(5):730-8. doi: 10.1046/j.1365-2141.2003.04343.x.
• [5] Chemopreventive activity of celastrol in drug-resistant human colon carcinoma cell cultures.Oncotarget. 2018 Apr 20;9(30):21211-21223. doi: 10.18632/oncotarget.25014. eCollection 2018 Apr 20.
• [6] ABCB1 genotype and CSF beta-amyloid in Alzheimer disease.J Geriatr Psychiatry Neurol. 2011 Jun;24(2):63-6. doi: 10.1177/0891988711402325. Epub 2011 Apr 8.
• [7] Investigating the Antiangiogenic, Anti-drug Resistance and Apoptotic Effects of Soy Isoflavone Extract Alone or in Combination with Docetaxel on Murine 4T1 Breast Tumor Model.Nutr Cancer. 2017 Oct;69(7):1036-1042. doi: 10.1080/01635581.2017.1359316. Epub 2017 Sep 22.
• [8] Ureaplasma infection-mediated release of matrix metalloproteinase-9 and PGP: a novel mechanism of preterm rupture of membranes and chorioamnionitis.Pediatr Res. 2017 Jan;81(1-1):75-79. doi: 10.1038/pr.2016.176. Epub 2016 Sep 15.
• [9] CD56 antigenic expression in acute myeloid leukemia identifies patients with poor clinical prognosis.Leukemia. 2001 Aug;15(8):1161-4. doi: 10.1038/sj.leu.2402174.
• [10] P-glycoprotein (PGP) polymorphisms and sexual dysfunction in female patients with depression and SSRI-associated sexual side effects.J Sex Marital Ther. 2013;39(3):280-8. doi: 10.1080/0092623X.2011.615896. Epub 2013 Jan 28.
• [11] Relationship between therapeutic efficacy of arterial infusion chemotherapy and expression of P-glycoprotein and p53 protein in advanced hepatocellular carcinoma.World J Gastroenterol. 2006 Feb 14;12(6):868-73. doi: 10.3748/wjg.v12.i6.868.
• [12] Innervation of the entire internal anal sphincter in a mouse model of Hirschsprung's disease: a first report.Pediatr Surg Int. 2019 Feb;35(2):209-214. doi: 10.1007/s00383-018-4397-z. Epub 2018 Nov 9.
• [13] Associations of allelic variants of the multidrug resistance gene (ABCB1 or MDR1) and inflammatory bowel disease and their effects on disease behavior: a case-control and meta-analysis study.Inflamm Bowel Dis. 2006 Apr;12(4):263-71. doi: 10.1097/01.MIB.0000209791.98866.ba.
• [14] Collagen-derived N-acetylated proline-glycine-proline upregulates the expression of pro-inflammatory cytokines and extracellular matrix proteases in nucleus pulposus cells via the NF-B and MAPK signaling pathways.Int J Mol Med. 2017 Jul;40(1):164-174. doi: 10.3892/ijmm.2017.3005. Epub 2017 May 29.
• [15] The influence of intracellular idarubicin and daunorubicin levels on drug cytotoxicity in childhood acute leukemia.Acta Biochim Pol. 2002;49(1):99-107.
• [16] Serial analysis of gene expression in non-small cell lung cancer.Cancer Res. 1998 Dec 15;58(24):5690-4.
• [17] Glycerol-3-phosphate phosphatase/PGP: Role in intermediary metabolism and target for cardiometabolic diseases.Biochimie. 2017 Dec;143:18-28. doi: 10.1016/j.biochi.2017.08.001. Epub 2017 Aug 5.
• [18] MiR-26b regulates 5-FU-resistance in human colorectal cancer via down-regulation of Pgp.Am J Cancer Res. 2018 Dec 1;8(12):2518-2527. eCollection 2018.
• [19] A pain in the skin. Regenerating nerve sprouts are distinctly associated with ongoing burning pain in patients with diabetes.Eur J Pain. 2018 Nov;22(10):1727-1734. doi: 10.1002/ejp.1259. Epub 2018 Jul 9.
• [20] Distinct pattern of enteric phospho-alpha-synuclein aggregates and gene expression profiles in patients with Parkinson's disease.Acta Neuropathol Commun. 2017 Jan 5;5(1):1. doi: 10.1186/s40478-016-0408-2.
• [21] Neuronal markers in allergic rhinitis: expression and correlation with sensory testing.Laryngoscope. 2007 Sep;117(9):1519-27. doi: 10.1097/MLG.0b013e3180ca7846.
• [22] The relationship between P-glycoprotein (PGP) polymorphisms and response to olanzapine treatment in schizophrenia. Ther Drug Monit. 2006 Oct;28(5):668-72.
• [23] P-glycoprotein expression in the squamous cell carcinoma of the tongue base.Laryngoscope. 1995 Dec;105(12 Pt 1):1294-9. doi: 10.1288/00005537-199512000-00006.
• [24] Polymorphic variations in GSTM1, GSTT1, PgP, CYP2D6, CYP3A5, and dopamine D2 and D3 receptors and their association with tardive dyskinesia in severe mental illness.J Clin Psychopharmacol. 2005 Oct;25(5):448-56. doi: 10.1097/01.jcp.0000177546.34799.af.
• [25] The Morphofunctional Changes in the Wall of Varicose Veins.Ann Vasc Surg. 2017 Jul;42:274-284. doi: 10.1016/j.avsg.2016.10.064. Epub 2017 Mar 11.
• [26] Tissue estimation of protein gene product 9.5 (PGP 9.5) expression and apoptosis in vitiligo.Int J Dermatol. 2008 Sep;47(9):911-7. doi: 10.1111/j.1365-4632.2008.03723.x.
• [27] Human prostate cancer cells express neuroendocrine cell markers PGP 9.5 and chromogranin A.Prostate. 2007 Dec 1;67(16):1761-9. doi: 10.1002/pros.20654.
• [28] Isolation and structural elucidation of pelgipeptin E, a novel pore-forming pelgipeptin analog from Paenibacillus elgii with low hemolytic activity.J Antibiot (Tokyo). 2018 Nov;71(12):1008-1017. doi: 10.1038/s41429-018-0095-2. Epub 2018 Aug 22.
• [29] Expression of growth-associated protein 43 in the skin nerve fibers of patients with type 2 diabetes mellitus.J Neurol Sci. 2012 Apr 15;315(1-2):60-3. doi: 10.1016/j.jns.2011.11.038. Epub 2011 Dec 29.
• [30] Developing a data sharing community for spinal cord injury research.Exp Neurol. 2017 Sep;295:135-143. doi: 10.1016/j.expneurol.2017.05.012. Epub 2017 May 30.
• [31] The anti-inflammatory effects of inhaled corticosteroids versus anti-leukotrienes on the lymphocyte P-glycoprotein (PGP) expression in asthmatic children.J Asthma. 2009 May;46(4):366-70. doi: 10.1080/02770900902777767.
• [32] Mapping of the familial Mediterranean fever gene to chromosome 16.Am J Reprod Immunol. 1992 Oct-Dec;28(3-4):241-2. doi: 10.1111/j.1600-0897.1992.tb00803.x.
• [33] The association between p53 protein phosphorylation at serine 15, serine 20 and sensitivity of cells isolated from patients with ovarian cancer and cell lines to chemotherapy in in vitro study.Pharmacol Rep. 2018 Jun;70(3):570-576. doi: 10.1016/j.pharep.2017.12.004. Epub 2017 Dec 15.
• [34] Effects of genetic polymorphisms of MDR1, FMO3 and CYP1A2 on susceptibility to colorectal cancer in Koreans.Cancer Sci. 2006 Aug;97(8):774-9. doi: 10.1111/j.1349-7006.2006.00241.x. Epub 2006 Jun 23.
• [35] Expression of protein gene product 9.5 and tyrosine hydroxylase in childhood small round cell tumors.Clin Cancer Res. 2000 Feb;6(2):551-8.
• [36] Study on the Intervention Effects of Pinggan Prescription () on Spontaneously Hypertensive Rats Based on Metabonomic and Pharmacodynamic Methods.Chin J Integr Med. 2019 May;25(5):348-353. doi: 10.1007/s11655-015-2126-1. Epub 2016 Dec 27.
• [37] In vitro induction of myeloid leukemia-specific CD4 and CD8 T cells by CD40 ligand-activated B cells gene modified to express primary granule proteins.Clin Cancer Res. 2005 Jun 15;11(12):4495-503. doi: 10.1158/1078-0432.CCR-04-2363.
• [38] The matrikine N-acetylated proline-glycine-proline induces premature senescence of nucleus pulposus cells via CXCR1-dependent ROS accumulation and DNA damage and reinforces the destructive effect of these cells on homeostasis of intervertebral discs.Biochim Biophys Acta Mol Basis Dis. 2017 Jan;1863(1):220-230. doi: 10.1016/j.bbadis.2016.10.011. Epub 2016 Oct 19.
• [39] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [40] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [41] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [46] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.