General Information of Drug Off-Target (DOT) (ID: OT7L2HGH)

DOT Name Putative POTE ankyrin domain family member M (POTEM)
Gene Name POTEM
Related Disease
Adult glioblastoma ( )
Glioblastoma multiforme ( )
Prostate cancer ( )
Prostate carcinoma ( )
Tuberculosis ( )
Adenocarcinoma ( )
Alzheimer disease ( )
Atrial fibrillation ( )
Breast cancer ( )
Breast carcinoma ( )
Cerebrovascular disease ( )
Clear cell renal carcinoma ( )
Congenital contractural arachnodactyly ( )
Dementia ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatitis ( )
Hepatocellular carcinoma ( )
Insomnia ( )
Malaria ( )
Multiple sclerosis ( )
Myocardial infarction ( )
Neoplasm ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Parkinson disease ( )
Pertussis ( )
Psychotic disorder ( )
Renal cell carcinoma ( )
Rheumatoid arthritis ( )
Schizophrenia ( )
Systemic sclerosis ( )
Bacterial infection ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Type-1 diabetes ( )
Advanced cancer ( )
Aplasia cutis congenita ( )
Asthma ( )
Chronic obstructive pulmonary disease ( )
Corpus callosum, agenesis of ( )
Liver cancer ( )
Mental disorder ( )
Neuroendocrine neoplasm ( )
Non-insulin dependent diabetes ( )
Uterine fibroids ( )
UniProt ID
POTEM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00023 ; PF12796
Sequence
MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSK
MGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSKVGPW
GDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQKRTALHLA
SANGNSEVVKLLLDRRCQLNILDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGN
TALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
LDRYGRTVLILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSRHNVICQLLSDY
KEKQILKVSSENSNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMK
KHGSTHMGFPENLPNGATADNGDDGLIPPRKSRTPESQQFPDTENEQYHSDEQNDTQKQL
SEEQNTGILQDEILIHEEKQIEVAENEF

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult glioblastoma DISVP4LU Definitive Biomarker [1]
Glioblastoma multiforme DISK8246 Definitive Biomarker [1]
Prostate cancer DISF190Y Definitive Biomarker [2]
Prostate carcinoma DISMJPLE Definitive Biomarker [2]
Tuberculosis DIS2YIMD Definitive Genetic Variation [3]
Adenocarcinoma DIS3IHTY Strong Biomarker [2]
Alzheimer disease DISF8S70 Strong Biomarker [4]
Atrial fibrillation DIS15W6U Strong Biomarker [5]
Breast cancer DIS7DPX1 Strong Genetic Variation [6]
Breast carcinoma DIS2UE88 Strong Genetic Variation [6]
Cerebrovascular disease DISAB237 Strong Genetic Variation [7]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [8]
Congenital contractural arachnodactyly DISOM1K7 Strong Genetic Variation [9]
Dementia DISXL1WY Strong Altered Expression [10]
Epithelial ovarian cancer DIS56MH2 Strong Genetic Variation [11]
Esophageal squamous cell carcinoma DIS5N2GV Strong Genetic Variation [12]
Glioma DIS5RPEH Strong Genetic Variation [13]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [14]
Hepatitis DISXXX35 Strong Genetic Variation [15]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [16]
Insomnia DIS0AFR7 Strong Biomarker [17]
Malaria DISQ9Y50 Strong Biomarker [18]
Multiple sclerosis DISB2WZI Strong Biomarker [19]
Myocardial infarction DIS655KI Strong Genetic Variation [20]
Neoplasm DISZKGEW Strong Altered Expression [21]
Ovarian cancer DISZJHAP Strong Genetic Variation [11]
Ovarian neoplasm DISEAFTY Strong Genetic Variation [11]
Parkinson disease DISQVHKL Strong Biomarker [22]
Pertussis DISQZUE7 Strong Biomarker [23]
Psychotic disorder DIS4UQOT Strong Biomarker [24]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [8]
Rheumatoid arthritis DISTSB4J Strong Biomarker [25]
Schizophrenia DISSRV2N Strong Genetic Variation [26]
Systemic sclerosis DISF44L6 Strong Altered Expression [27]
Bacterial infection DIS5QJ9S moderate Altered Expression [28]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W moderate Biomarker [29]
Type-1 diabetes DIS7HLUB moderate Genetic Variation [30]
Advanced cancer DISAT1Z9 Limited Biomarker [8]
Aplasia cutis congenita DISMDAYM Limited Biomarker [31]
Asthma DISW9QNS Limited Biomarker [32]
Chronic obstructive pulmonary disease DISQCIRF Limited Genetic Variation [33]
Corpus callosum, agenesis of DISO9P40 Limited Biomarker [31]
Liver cancer DISDE4BI Limited Biomarker [29]
Mental disorder DIS3J5R8 Limited Biomarker [24]
Neuroendocrine neoplasm DISNPLOO Limited Genetic Variation [34]
Non-insulin dependent diabetes DISK1O5Z Limited Genetic Variation [35]
Uterine fibroids DISBZRMJ Limited Biomarker [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Putative POTE ankyrin domain family member M (POTEM). [36]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Putative POTE ankyrin domain family member M (POTEM). [37]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Putative POTE ankyrin domain family member M (POTEM). [38]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Putative POTE ankyrin domain family member M (POTEM). [39]
Testosterone DM7HUNW Approved Testosterone increases the expression of Putative POTE ankyrin domain family member M (POTEM). [38]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Putative POTE ankyrin domain family member M (POTEM). [39]
Nabiximols DMHKJ5I Phase 3 Nabiximols decreases the expression of Putative POTE ankyrin domain family member M (POTEM). [40]
MGCD-0103 DM726HX Phase 2 MGCD-0103 increases the expression of Putative POTE ankyrin domain family member M (POTEM). [39]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Putative POTE ankyrin domain family member M (POTEM). [41]
Tacedinaline DM1Z74X Discontinued in Phase 2 Tacedinaline increases the expression of Putative POTE ankyrin domain family member M (POTEM). [39]
Scriptaid DM9JZ21 Preclinical Scriptaid increases the expression of Putative POTE ankyrin domain family member M (POTEM). [39]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Putative POTE ankyrin domain family member M (POTEM). [42]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Putative POTE ankyrin domain family member M (POTEM). [43]
Octanedioic acid bis-hydroxyamide DMJNQ9K Investigative Octanedioic acid bis-hydroxyamide increases the expression of Putative POTE ankyrin domain family member M (POTEM). [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 Rindopepimut with temozolomide for patients with newly diagnosed, EGFRvIII-expressing glioblastoma (ACT IV): a randomised, double-blind, international phase 3 trial.Lancet Oncol. 2017 Oct;18(10):1373-1385. doi: 10.1016/S1470-2045(17)30517-X. Epub 2017 Aug 23.
2 Early Response Monitoring Following Radiation Therapy by Using [(18)F]FDG and [(11)C]Acetate PET in Prostate Cancer Xenograft Model with Metabolomics Corroboration.Molecules. 2017 Nov 10;22(11):1946. doi: 10.3390/molecules22111946.
3 Mutations in lysX as the new and reliable markers for tuberculosis Beijing and modern Beijing strains.Tuberculosis (Edinb). 2016 Mar;97:33-7. doi: 10.1016/j.tube.2015.12.006. Epub 2015 Dec 29.
4 Inflammatory markers in Alzheimer's disease and mild cognitive impairment: a meta-analysis and systematic review of 170 studies.J Neurol Neurosurg Psychiatry. 2019 May;90(5):590-598. doi: 10.1136/jnnp-2018-319148. Epub 2019 Jan 10.
5 Paroxysmal Atrial Fibrillation in the Course of Acute Pulmonary Embolism: Clinical Significance and Impact on Prognosis.Biomed Res Int. 2017;2017:5049802. doi: 10.1155/2017/5049802. Epub 2017 Feb 9.
6 Association of vitamin D receptor gene polymorphisms with breast cancer risk in an Egyptian population.Tumour Biol. 2017 Oct;39(10):1010428317727738. doi: 10.1177/1010428317727738.
7 alpha-1-Antichymotrypsin gene A1252G variant (ACT Isehara-1) is associated with a lacunar type of ischemic cerebrovascular disease.J Hum Genet. 2001;46(1):45-7. doi: 10.1007/s100380170125.
8 Dual-Tracer PET/CT Differentiates 2 Types of Primary Cancers and Metastases in a Patient With Crossed Fused Renal Ectopia.Clin Nucl Med. 2019 Feb;44(2):157-158. doi: 10.1097/RLU.0000000000002390.
9 A novel nonstop mutation in the stop codon and a novel missense mutation in the type II 3beta-hydroxysteroid dehydrogenase (3beta-HSD) gene causing, respectively, nonclassic and classic 3beta-HSD deficiency congenital adrenal hyperplasia.J Clin Endocrinol Metab. 2002 Jun;87(6):2556-63. doi: 10.1210/jcem.87.6.8559.
10 Alpha1-antichymotrypsin, an inflammatory protein overexpressed in Alzheimer's disease brain, induces tau phosphorylation in neurons.Brain. 2006 Nov;129(Pt 11):3020-34. doi: 10.1093/brain/awl255. Epub 2006 Sep 20.
11 Breast and ovarian cancer referrals to the ACT Genetic Service: are we meeting guidelines?.Intern Med J. 2017 Mar;47(3):311-317. doi: 10.1111/imj.13357.
12 Association between the genetic variations within TBX21 gene promoter and the clinicopathological characteristics of esophageal squamous cell carcinoma in a high-risk Chinese population.Tumour Biol. 2015 May;36(5):3985-93. doi: 10.1007/s13277-015-3042-x. Epub 2015 Jan 11.
13 Possible association between polymorphisms of human vascular endothelial growth factor A gene and susceptibility to glioma in a Chinese population.Int J Cancer. 2011 Jan 1;128(1):166-75. doi: 10.1002/ijc.25306.
14 Ionizing radiation and TNF-alpha and stimulated expression of alpha1-antichymotrypsin gene in human squamous carcinoma cells.Acta Oncol. 1998;37(5):475-8. doi: 10.1080/028418698430430.
15 Enhancement of hepatitis virus immunoassay outcome predictions in imbalanced routine pathology data by data balancing and feature selection before the application of support vector machines.BMC Med Inform Decis Mak. 2017 Aug 14;17(1):121. doi: 10.1186/s12911-017-0522-5.
16 Expression Profiling of lncRNAs, miRNAs, and mRNAs and Their Differential Expression in Leiomyoma Using Next-Generation RNA Sequencing.Reprod Sci. 2018 Feb;25(2):246-255. doi: 10.1177/1933719117711265. Epub 2017 Jun 7.
17 Clinical pharmacology of the dual orexin receptor antagonist ACT-541468 in elderly subjects: Exploration of pharmacokinetics, pharmacodynamics and tolerability following single-dose morning and repeated-dose evening administration.J Psychopharmacol. 2020 Mar;34(3):326-335. doi: 10.1177/0269881119882854. Epub 2019 Oct 23.
18 Mass drug administration can be a valuable addition to the malaria elimination toolbox.Malar J. 2019 Aug 22;18(1):281. doi: 10.1186/s12936-019-2906-8.
19 Using mixed methods case-series evaluation in the development of a guided self-management hybrid CBT and ACT intervention for multiple sclerosis pain.Disabil Rehabil. 2017 Sep;39(18):1785-1798. doi: 10.1080/09638288.2016.1209580. Epub 2016 Aug 24.
20 Effects of l-arginine supplementation associated with continuous or interval aerobic training on chronic heart failure rats.Metabolism. 2017 Nov;76:1-10. doi: 10.1016/j.metabol.2017.06.009. Epub 2017 Jul 5.
21 Bispecific Antibodies Enable Synthetic Agonistic Receptor-Transduced T Cells for Tumor Immunotherapy.Clin Cancer Res. 2019 Oct 1;25(19):5890-5900. doi: 10.1158/1078-0432.CCR-18-3927. Epub 2019 Jul 8.
22 Genetic study of apolipoprotein E gene, alpha-1 antichymotrypsin gene in sporadic Parkinson disease.Am J Med Genet. 2002 May 8;114(4):446-9. doi: 10.1002/ajmg.10249.
23 Membrane Permeabilization by Pore-Forming RTX Toxins: What Kind of Lesions Do These Toxins Form?.Toxins (Basel). 2019 Jun 18;11(6):354. doi: 10.3390/toxins11060354.
24 Outcomes of clients in need of intensive team care in Flexible Assertive Community Treatment in Sweden.Nord J Psychiatry. 2018 Apr;72(3):226-231. doi: 10.1080/08039488.2018.1430168. Epub 2018 Jan 26.
25 Efficacy of tocilizumab monotherapy after response to combined tocilizumab and methotrexate in patients with rheumatoid arthritis: the randomised JUST-ACT study.Clin Exp Rheumatol. 2019 May-Jun;37(3):437-444. Epub 2018 Sep 17.
26 Association of CCL11 promoter polymorphisms with schizophrenia in a Korean population.Gene. 2018 May 20;656:80-85. doi: 10.1016/j.gene.2018.02.053. Epub 2018 Feb 22.
27 Effects of selexipag and its active metabolite in contrasting the profibrotic myofibroblast activity in cultured scleroderma skin fibroblasts.Arthritis Res Ther. 2018 May 2;20(1):77. doi: 10.1186/s13075-018-1577-0.
28 Phospholipase A activity of adenylate cyclase toxin mediates translocation of its adenylate cyclase domain.Proc Natl Acad Sci U S A. 2017 Aug 15;114(33):E6784-E6793. doi: 10.1073/pnas.1701783114. Epub 2017 Jul 31.
29 Alpha1-ACT Functions as a Tumour Suppressor in Hepatocellular Carcinoma by Inhibiting the PI3K/AKT/mTOR Signalling Pathway via Activation of PTEN.Cell Physiol Biochem. 2017;41(6):2289-2306. doi: 10.1159/000475648. Epub 2017 Apr 26.
30 No abnormalities of reg1 alpha and reg1 beta gene associated with diabetes mellitus.Diabetes Res Clin Pract. 2002 Feb;55(2):105-11. doi: 10.1016/s0168-8227(01)00321-7.
31 Adrenocortical carcinoma -- improving patient care by establishing new structures.Exp Clin Endocrinol Diabetes. 2006 Feb;114(2):45-51. doi: 10.1055/s-2006-923808.
32 A Pragmatic Trial of Symptom-Based Inhaled Corticosteroid Use in African-American Children with Mild Asthma.J Allergy Clin Immunol Pract. 2020 Jan;8(1):176-185.e2. doi: 10.1016/j.jaip.2019.06.030. Epub 2019 Jul 30.
33 COPD patients prescribed inhaled corticosteroid in general practice: Based on disease characteristics according to guidelines?.Chron Respir Dis. 2019 Jan-Dec;16:1479973119867949. doi: 10.1177/1479973119867949.
34 Dual role of RASSF1 as a tumor suppressor and an oncogene in neuroendocrine tumors of the lung.Anticancer Res. 2010 Oct;30(10):4269-81.
35 Decreased tolbutamide-stimulated insulin secretion in healthy subjects with sequence variants in the high-affinity sulfonylurea receptor gene.Diabetes. 1998 Apr;47(4):598-605. doi: 10.2337/diabetes.47.4.598.
36 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
38 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
39 Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
40 Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
41 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
42 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
43 Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.