Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7L2HGH)

• DOT Name: Putative POTE ankyrin domain family member M (POTEM)
• Gene Name: POTEM
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Prostate cancer
  Prostate carcinoma
  Tuberculosis
  Adenocarcinoma
  Alzheimer disease
  Atrial fibrillation
  Breast cancer
  Breast carcinoma
  Cerebrovascular disease
  Clear cell renal carcinoma
  Congenital contractural arachnodactyly
  Dementia
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioma
  Head-neck squamous cell carcinoma
  Hepatitis
  Hepatocellular carcinoma
  Insomnia
  Malaria
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Pertussis
  Psychotic disorder
  Renal cell carcinoma
  Rheumatoid arthritis
  Schizophrenia
  Systemic sclerosis
  Bacterial infection
  Carcinoma of liver and intrahepatic biliary tract
  Type-1 diabetes
  Advanced cancer
  Aplasia cutis congenita
  Asthma
  Chronic obstructive pulmonary disease
  Corpus callosum, agenesis of
  Liver cancer
  Mental disorder
  Neuroendocrine neoplasm
  Non-insulin dependent diabetes
  Uterine fibroids
• UniProt ID: POTEM_HUMAN
• Pfam ID: PF00023 ; PF12796
• Sequence:
  MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSK
  MGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSKVGPW
  GDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQKRTALHLA
  SANGNSEVVKLLLDRRCQLNILDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGN
  TALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
  LDRYGRTVLILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSRHNVICQLLSDY
  KEKQILKVSSENSNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMK
  KHGSTHMGFPENLPNGATADNGDDGLIPPRKSRTPESQQFPDTENEQYHSDEQNDTQKQL
  SEEQNTGILQDEILIHEEKQIEVAENEF

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Prostate cancer	DISF190Y	Definitive	Biomarker	[2]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[2]
Tuberculosis	DIS2YIMD	Definitive	Genetic Variation	[3]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[6]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[6]
Cerebrovascular disease	DISAB237	Strong	Genetic Variation	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Congenital contractural arachnodactyly	DISOM1K7	Strong	Genetic Variation	[9]
Dementia	DISXL1WY	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[12]
Glioma	DIS5RPEH	Strong	Genetic Variation	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[14]
Hepatitis	DISXXX35	Strong	Genetic Variation	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
Insomnia	DIS0AFR7	Strong	Biomarker	[17]
Malaria	DISQ9Y50	Strong	Biomarker	[18]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[19]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[20]
Neoplasm	DISZKGEW	Strong	Altered Expression	[21]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[11]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[11]
Parkinson disease	DISQVHKL	Strong	Biomarker	[22]
Pertussis	DISQZUE7	Strong	Biomarker	[23]
Psychotic disorder	DIS4UQOT	Strong	Biomarker	[24]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[8]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[25]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[26]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[27]
Bacterial infection	DIS5QJ9S	moderate	Altered Expression	[28]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[29]
Type-1 diabetes	DIS7HLUB	moderate	Genetic Variation	[30]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[8]
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[31]
Asthma	DISW9QNS	Limited	Biomarker	[32]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Genetic Variation	[33]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[31]
Liver cancer	DISDE4BI	Limited	Biomarker	[29]
Mental disorder	DIS3J5R8	Limited	Biomarker	[24]
Neuroendocrine neoplasm	DISNPLOO	Limited	Genetic Variation	[34]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[35]
Uterine fibroids	DISBZRMJ	Limited	Biomarker	[16]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Putative POTE ankyrin domain family member M (POTEM).	[36]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Putative POTE ankyrin domain family member M (POTEM).	[37]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[38]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[39]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[38]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[39]
Nabiximols	DMHKJ5I	Phase 3	Nabiximols decreases the expression of Putative POTE ankyrin domain family member M (POTEM).	[40]
MGCD-0103	DM726HX	Phase 2	MGCD-0103 increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[41]
Tacedinaline	DM1Z74X	Discontinued in Phase 2	Tacedinaline increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[39]
Scriptaid	DM9JZ21	Preclinical	Scriptaid increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Putative POTE ankyrin domain family member M (POTEM).	[42]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[43]
Octanedioic acid bis-hydroxyamide	DMJNQ9K	Investigative	Octanedioic acid bis-hydroxyamide increases the expression of Putative POTE ankyrin domain family member M (POTEM).	[39]

References

• [1] Rindopepimut with temozolomide for patients with newly diagnosed, EGFRvIII-expressing glioblastoma (ACT IV): a randomised, double-blind, international phase 3 trial.Lancet Oncol. 2017 Oct;18(10):1373-1385. doi: 10.1016/S1470-2045(17)30517-X. Epub 2017 Aug 23.
• [2] Early Response Monitoring Following Radiation Therapy by Using [(18)F]FDG and [(11)C]Acetate PET in Prostate Cancer Xenograft Model with Metabolomics Corroboration.Molecules. 2017 Nov 10;22(11):1946. doi: 10.3390/molecules22111946.
• [3] Mutations in lysX as the new and reliable markers for tuberculosis Beijing and modern Beijing strains.Tuberculosis (Edinb). 2016 Mar;97:33-7. doi: 10.1016/j.tube.2015.12.006. Epub 2015 Dec 29.
• [4] Inflammatory markers in Alzheimer's disease and mild cognitive impairment: a meta-analysis and systematic review of 170 studies.J Neurol Neurosurg Psychiatry. 2019 May;90(5):590-598. doi: 10.1136/jnnp-2018-319148. Epub 2019 Jan 10.
• [5] Paroxysmal Atrial Fibrillation in the Course of Acute Pulmonary Embolism: Clinical Significance and Impact on Prognosis.Biomed Res Int. 2017;2017:5049802. doi: 10.1155/2017/5049802. Epub 2017 Feb 9.
• [6] Association of vitamin D receptor gene polymorphisms with breast cancer risk in an Egyptian population.Tumour Biol. 2017 Oct;39(10):1010428317727738. doi: 10.1177/1010428317727738.
• [7] alpha-1-Antichymotrypsin gene A1252G variant (ACT Isehara-1) is associated with a lacunar type of ischemic cerebrovascular disease.J Hum Genet. 2001;46(1):45-7. doi: 10.1007/s100380170125.
• [8] Dual-Tracer PET/CT Differentiates 2 Types of Primary Cancers and Metastases in a Patient With Crossed Fused Renal Ectopia.Clin Nucl Med. 2019 Feb;44(2):157-158. doi: 10.1097/RLU.0000000000002390.
• [9] A novel nonstop mutation in the stop codon and a novel missense mutation in the type II 3beta-hydroxysteroid dehydrogenase (3beta-HSD) gene causing, respectively, nonclassic and classic 3beta-HSD deficiency congenital adrenal hyperplasia.J Clin Endocrinol Metab. 2002 Jun;87(6):2556-63. doi: 10.1210/jcem.87.6.8559.
• [10] Alpha1-antichymotrypsin, an inflammatory protein overexpressed in Alzheimer's disease brain, induces tau phosphorylation in neurons.Brain. 2006 Nov;129(Pt 11):3020-34. doi: 10.1093/brain/awl255. Epub 2006 Sep 20.
• [11] Breast and ovarian cancer referrals to the ACT Genetic Service: are we meeting guidelines?.Intern Med J. 2017 Mar;47(3):311-317. doi: 10.1111/imj.13357.
• [12] Association between the genetic variations within TBX21 gene promoter and the clinicopathological characteristics of esophageal squamous cell carcinoma in a high-risk Chinese population.Tumour Biol. 2015 May;36(5):3985-93. doi: 10.1007/s13277-015-3042-x. Epub 2015 Jan 11.
• [13] Possible association between polymorphisms of human vascular endothelial growth factor A gene and susceptibility to glioma in a Chinese population.Int J Cancer. 2011 Jan 1;128(1):166-75. doi: 10.1002/ijc.25306.
• [14] Ionizing radiation and TNF-alpha and stimulated expression of alpha1-antichymotrypsin gene in human squamous carcinoma cells.Acta Oncol. 1998;37(5):475-8. doi: 10.1080/028418698430430.
• [15] Enhancement of hepatitis virus immunoassay outcome predictions in imbalanced routine pathology data by data balancing and feature selection before the application of support vector machines.BMC Med Inform Decis Mak. 2017 Aug 14;17(1):121. doi: 10.1186/s12911-017-0522-5.
• [16] Expression Profiling of lncRNAs, miRNAs, and mRNAs and Their Differential Expression in Leiomyoma Using Next-Generation RNA Sequencing.Reprod Sci. 2018 Feb;25(2):246-255. doi: 10.1177/1933719117711265. Epub 2017 Jun 7.
• [17] Clinical pharmacology of the dual orexin receptor antagonist ACT-541468 in elderly subjects: Exploration of pharmacokinetics, pharmacodynamics and tolerability following single-dose morning and repeated-dose evening administration.J Psychopharmacol. 2020 Mar;34(3):326-335. doi: 10.1177/0269881119882854. Epub 2019 Oct 23.
• [18] Mass drug administration can be a valuable addition to the malaria elimination toolbox.Malar J. 2019 Aug 22;18(1):281. doi: 10.1186/s12936-019-2906-8.
• [19] Using mixed methods case-series evaluation in the development of a guided self-management hybrid CBT and ACT intervention for multiple sclerosis pain.Disabil Rehabil. 2017 Sep;39(18):1785-1798. doi: 10.1080/09638288.2016.1209580. Epub 2016 Aug 24.
• [20] Effects of l-arginine supplementation associated with continuous or interval aerobic training on chronic heart failure rats.Metabolism. 2017 Nov;76:1-10. doi: 10.1016/j.metabol.2017.06.009. Epub 2017 Jul 5.
• [21] Bispecific Antibodies Enable Synthetic Agonistic Receptor-Transduced T Cells for Tumor Immunotherapy.Clin Cancer Res. 2019 Oct 1;25(19):5890-5900. doi: 10.1158/1078-0432.CCR-18-3927. Epub 2019 Jul 8.
• [22] Genetic study of apolipoprotein E gene, alpha-1 antichymotrypsin gene in sporadic Parkinson disease.Am J Med Genet. 2002 May 8;114(4):446-9. doi: 10.1002/ajmg.10249.
• [23] Membrane Permeabilization by Pore-Forming RTX Toxins: What Kind of Lesions Do These Toxins Form?.Toxins (Basel). 2019 Jun 18;11(6):354. doi: 10.3390/toxins11060354.
• [24] Outcomes of clients in need of intensive team care in Flexible Assertive Community Treatment in Sweden.Nord J Psychiatry. 2018 Apr;72(3):226-231. doi: 10.1080/08039488.2018.1430168. Epub 2018 Jan 26.
• [25] Efficacy of tocilizumab monotherapy after response to combined tocilizumab and methotrexate in patients with rheumatoid arthritis: the randomised JUST-ACT study.Clin Exp Rheumatol. 2019 May-Jun;37(3):437-444. Epub 2018 Sep 17.
• [26] Association of CCL11 promoter polymorphisms with schizophrenia in a Korean population.Gene. 2018 May 20;656:80-85. doi: 10.1016/j.gene.2018.02.053. Epub 2018 Feb 22.
• [27] Effects of selexipag and its active metabolite in contrasting the profibrotic myofibroblast activity in cultured scleroderma skin fibroblasts.Arthritis Res Ther. 2018 May 2;20(1):77. doi: 10.1186/s13075-018-1577-0.
• [28] Phospholipase A activity of adenylate cyclase toxin mediates translocation of its adenylate cyclase domain.Proc Natl Acad Sci U S A. 2017 Aug 15;114(33):E6784-E6793. doi: 10.1073/pnas.1701783114. Epub 2017 Jul 31.
• [29] Alpha1-ACT Functions as a Tumour Suppressor in Hepatocellular Carcinoma by Inhibiting the PI3K/AKT/mTOR Signalling Pathway via Activation of PTEN.Cell Physiol Biochem. 2017;41(6):2289-2306. doi: 10.1159/000475648. Epub 2017 Apr 26.
• [30] No abnormalities of reg1 alpha and reg1 beta gene associated with diabetes mellitus.Diabetes Res Clin Pract. 2002 Feb;55(2):105-11. doi: 10.1016/s0168-8227(01)00321-7.
• [31] Adrenocortical carcinoma -- improving patient care by establishing new structures.Exp Clin Endocrinol Diabetes. 2006 Feb;114(2):45-51. doi: 10.1055/s-2006-923808.
• [32] A Pragmatic Trial of Symptom-Based Inhaled Corticosteroid Use in African-American Children with Mild Asthma.J Allergy Clin Immunol Pract. 2020 Jan;8(1):176-185.e2. doi: 10.1016/j.jaip.2019.06.030. Epub 2019 Jul 30.
• [33] COPD patients prescribed inhaled corticosteroid in general practice: Based on disease characteristics according to guidelines?.Chron Respir Dis. 2019 Jan-Dec;16:1479973119867949. doi: 10.1177/1479973119867949.
• [34] Dual role of RASSF1 as a tumor suppressor and an oncogene in neuroendocrine tumors of the lung.Anticancer Res. 2010 Oct;30(10):4269-81.
• [35] Decreased tolbutamide-stimulated insulin secretion in healthy subjects with sequence variants in the high-affinity sulfonylurea receptor gene.Diabetes. 1998 Apr;47(4):598-605. doi: 10.2337/diabetes.47.4.598.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [38] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [39] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [40] Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
• [41] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [42] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [43] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.