Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAVQ78J)

• DOT Name: E3 SUMO-protein ligase EGR2 (EGR2)
• Synonyms: EC 2.3.2.-; AT591; E3 SUMO-protein transferase ERG2; Early growth response protein 2; EGR-2; Zinc finger protein Krox-20
• Gene Name: EGR2
• Related Disease:
  Bipolar disorder
  Charcot marie tooth disease
  Charcot-Marie-Tooth disease type 4E
  Demyelinating polyneuropathy
  Hereditary motor and sensory neuropathy
  Non-insulin dependent diabetes
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Atopic dermatitis
  Autoimmune disease
  Bone osteosarcoma
  Breast carcinoma
  Cervical cancer
  Cervical carcinoma
  Charcot-Marie-Tooth disease type 1D
  Gastric cancer
  Hepatitis B virus infection
  Lupus
  Myocardial ischemia
  Neuropathy, congenital hypomelinating
  Non-small-cell lung cancer
  Osteoarthritis
  Osteosarcoma
  Stomach cancer
  Systemic lupus erythematosus
  Systemic sclerosis
  Uterine fibroids
  Charcot-Marie-Tooth disease type 1
  Charcot-Marie-Tooth disease type 3
  Ewing sarcoma
  Hepatocellular carcinoma
  Autism
  Colorectal carcinoma
  Nervous system inflammation
  Neuroblastoma
  Rett syndrome
  Rheumatoid arthritis
  Small lymphocytic lymphoma
  Stroke
  Thyroid gland papillary carcinoma
  Wilms tumor
• UniProt ID: EGR2_HUMAN
• EC Number: 2.3.2.-
• Pfam ID: PF11928 ; PF00096
• Sequence:
  MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMI
  NIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI
  LQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGD
  LYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHG
  TAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSA
  AAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRH
  IRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH
  LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP
• Function: Sequence-specific DNA-binding transcription factor. Plays a role in hindbrain segmentation by regulating the expression of a subset of homeobox containing genes and in Schwann cell myelination by regulating the expression of genes involved in the formation and maintenance of myelin. Binds to two EGR2-consensus sites EGR2A (5'-CTGTAGGAG-3') and EGR2B (5'-ATGTAGGTG-3') in the HOXB3 enhancer and promotes HOXB3 transcriptional activation. Binds to specific DNA sites located in the promoter region of HOXA4, HOXB2 and ERBB2. Regulates hindbrain segmentation by controlling the expression of Hox genes, such as HOXA4, HOXB3 and HOXB2, and thereby specifying odd and even rhombomeres. Promotes the expression of HOXB3 in the rhombomere r5 in the hindbrain. Regulates myelination in the peripheral nervous system after birth, possibly by regulating the expression of myelin proteins, such as MPZ, and by promoting the differentiation of Schwann cells. Involved in the development of the jaw openener musculature, probably by playing a role in its innervation through trigeminal motor neurons. May play a role in adipogenesis, possibly by regulating the expression of CEBPB; E3 SUMO-protein ligase helping SUMO1 conjugation to its coregulators NAB1 and NAB2, whose sumoylation down-regulates EGR2 transcriptional activity.
• KEGG Pathway:
  C-type lectin receptor sig.ling pathway (hsa04625)
  Hepatitis B (hsa05161)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Viral carcinogenesis (hsa05203)
• Reactome Pathway:
  Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472)
  NGF-stimulated transcription (R-HSA-9031628)
  EGR2 and SOX10-mediated initiation of Schwann cell myelination (R-HSA-9619665)
  Transcriptional regulation of white adipocyte differentiation (R-HSA-381340)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bipolar disorder	DISAM7J2	Definitive	Biomarker	[1]
Charcot marie tooth disease	DIS3BT2L	Definitive	Semidominant	[2]
Charcot-Marie-Tooth disease type 4E	DIS5RRJE	Definitive	Autosomal recessive	[3]
Demyelinating polyneuropathy	DIS7IO4W	Definitive	Genetic Variation	[4]
Hereditary motor and sensory neuropathy	DISR0X2K	Definitive	Biomarker	[5]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[6]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[7]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[8]
Alzheimer disease	DISF8S70	Strong	Biomarker	[9]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[10]
Autoimmune disease	DISORMTM	Strong	Biomarker	[8]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[11]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[12]
Cervical cancer	DISFSHPF	Strong	Genetic Variation	[13]
Cervical carcinoma	DIST4S00	Strong	Genetic Variation	[13]
Charcot-Marie-Tooth disease type 1D	DISGYWZT	Strong	Autosomal dominant	[14]
Gastric cancer	DISXGOUK	Strong	Biomarker	[15]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[16]
Lupus	DISOKJWA	Strong	Biomarker	[17]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[18]
Neuropathy, congenital hypomelinating	DISZUW4L	Strong	Genetic Variation	[4]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[19]
Osteoarthritis	DIS05URM	Strong	Biomarker	[20]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[11]
Stomach cancer	DISKIJSX	Strong	Biomarker	[15]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[21]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[22]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[23]
Charcot-Marie-Tooth disease type 1	DIS56F9A	moderate	CausalMutation	[24]
Charcot-Marie-Tooth disease type 3	DIS6DQK1	Moderate	Semidominant	[14]
Ewing sarcoma	DISQYLV3	moderate	Genetic Variation	[25]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[26]
Autism	DISV4V1Z	Limited	Biomarker	[27]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[28]
Nervous system inflammation	DISB3X5A	Limited	Altered Expression	[29]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[27]
Rett syndrome	DISGG5UV	Limited	Altered Expression	[27]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[30]
Small lymphocytic lymphoma	DIS30POX	Limited	Genetic Variation	[28]
Stroke	DISX6UHX	Limited	Biomarker	[31]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Biomarker	[32]
Wilms tumor	DISB6T16	Limited	Biomarker	[33]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of E3 SUMO-protein ligase EGR2 (EGR2).	[34]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of E3 SUMO-protein ligase EGR2 (EGR2).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of E3 SUMO-protein ligase EGR2 (EGR2).	[56]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of E3 SUMO-protein ligase EGR2 (EGR2).	[57]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[40]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[42]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[44]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[45]
Marinol	DM70IK5	Approved	Marinol decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[46]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[47]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[48]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[49]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[50]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[51]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[52]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[53]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[54]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[55]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[58]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[54]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[59]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[60]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[61]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[62]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[63]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide increases the expression of E3 SUMO-protein ligase EGR2 (EGR2).	[64]

References

• [1] Lack of association of EGR2 variants with bipolar disorder in Japanese population.Gene. 2013 Sep 10;526(2):246-50. doi: 10.1016/j.gene.2013.05.055. Epub 2013 Jun 4.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
• [4] A novel family with axonal Charcot-Marie-Tooth disease caused by a mutation in the EGR2 gene.J Peripher Nerv Syst. 2019 Jun;24(2):219-223. doi: 10.1111/jns.12314. Epub 2019 Mar 28.
• [5] Congenital hypomyelinating neuropathy with lethal conduction failure in mice carrying the Egr2 I268N mutation.J Neurosci. 2009 Feb 25;29(8):2312-21. doi: 10.1523/JNEUROSCI.2168-08.2009.
• [6] Egr2 enhances insulin resistance via JAK2/STAT3/SOCS-1 pathway in HepG2 cells treated with palmitate.Gen Comp Endocrinol. 2018 May 1;260:25-31. doi: 10.1016/j.ygcen.2017.08.023. Epub 2017 Aug 24.
• [7] Bone marrow mesenchymal stromal cells from acute myelogenous leukemia patients demonstrate adipogenic differentiation propensity with implications for leukemia cell support.Leukemia. 2020 Feb;34(2):391-403. doi: 10.1038/s41375-019-0568-8. Epub 2019 Sep 6.
• [8] Egr2-independent, Klf1-mediated induction of PD-L1 in CD4(+) T cells.Sci Rep. 2018 May 4;8(1):7021. doi: 10.1038/s41598-018-25302-1.
• [9] Expression of Fos, Jun, and Krox family proteins in Alzheimer's disease.Exp Neurol. 1997 Oct;147(2):316-32. doi: 10.1006/exnr.1997.6600.
• [10] Staphylococcal enterotoxins modulate the effector CD4(+) T cell response by reshaping the gene expression profile in adults with atopic dermatitis.Sci Rep. 2019 Sep 11;9(1):13082. doi: 10.1038/s41598-019-49421-5.
• [11] IL-10 inhibits cysteinyl leukotriene-induced activation of human monocytes and monocyte-derived dendritic cells.J Immunol. 2008 Jun 1;180(11):7597-603. doi: 10.4049/jimmunol.180.11.7597.
• [12] Expression and prognostic analyses of early growth response proteins (EGRs) in human breast carcinoma based on database analysis.PeerJ. 2019 Dec 9;7:e8183. doi: 10.7717/peerj.8183. eCollection 2019.
• [13] XRCC1 mediated the development of cervival cancer through a novel Sp1/Krox-20 swich.Oncotarget. 2017 Sep 16;8(49):86217-86226. doi: 10.18632/oncotarget.21040. eCollection 2017 Oct 17.
• [14] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [15] MiR-150 promotes gastric cancer proliferation by negatively regulating the pro-apoptotic gene EGR2.Biochem Biophys Res Commun. 2010 Feb 12;392(3):340-5. doi: 10.1016/j.bbrc.2009.12.182. Epub 2010 Jan 11.
• [16] Hepatitis B virus X protein induces expression of Fas ligand gene through enhancing transcriptional activity of early growth response factor.J Biol Chem. 2004 Aug 27;279(35):36242-9. doi: 10.1074/jbc.M401290200. Epub 2004 Jun 1.
• [17] Early growth response transcription factors and the modulation of immune response: implications towards autoimmunity.Autoimmun Rev. 2010 Apr;9(6):454-8. doi: 10.1016/j.autrev.2009.12.006. Epub 2009 Dec 23.
• [18] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [19] MicroRNA-20a promotes proliferation and invasion by directly targeting early growth response 2 in non-small cell lung carcinoma.Oncol Lett. 2018 Jan;15(1):271-277. doi: 10.3892/ol.2017.7299. Epub 2017 Oct 31.
• [20] Obtain osteoarthritis related molecular signature genes through regulation network.Mol Med Rep. 2012 Jan;5(1):177-83. doi: 10.3892/mmr.2011.595. Epub 2011 Sep 22.
• [21] Dysregulation of anergy-related factors involved in regulatory T cells defects in Systemic Lupus Erythematosus patients: Rapamycin and Vitamin D efficacy in restoring regulatory T cells.Int J Rheum Dis. 2016 Dec;19(12):1294-1303. doi: 10.1111/1756-185X.12509. Epub 2014 Oct 28.
• [22] The early growth response gene Egr2 (Alias Krox20) is a novel transcriptional target of transforming growth factor- that is up-regulated in systemic sclerosis and mediates profibrotic responses.Am J Pathol. 2011 May;178(5):2077-90. doi: 10.1016/j.ajpath.2011.01.035.
• [23] Early growth response-2 expression in uterine leiomyoma cells: regulation and function.Fertil Steril. 2011 Aug;96(2):439-44. doi: 10.1016/j.fertnstert.2011.05.062. Epub 2011 Jun 24.
• [24] Survey of variation in human transcription factors reveals prevalent DNA binding changes.Science. 2016 Mar 25;351(6280):1450-1454. doi: 10.1126/science.aad2257. Epub 2016 Mar 24.
• [25] CD99 polymorphisms significantly influence the probability to develop Ewing sarcoma in earlier age and patient disease progression.Oncotarget. 2016 Nov 22;7(47):77958-77967. doi: 10.18632/oncotarget.12862.
• [26] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [27] Reciprocal co-regulation of EGR2 and MECP2 is disrupted in Rett syndrome and autism.Hum Mol Genet. 2009 Feb 1;18(3):525-34. doi: 10.1093/hmg/ddn380. Epub 2008 Nov 10.
• [28] EGR2 mutations define a new clinically aggressive subgroup of chronic lymphocytic leukemia.Leukemia. 2017 Jul;31(7):1547-1554. doi: 10.1038/leu.2016.359. Epub 2016 Nov 28.
• [29] Early growth response gene-2 controls IL-17 expression and Th17 differentiation by negatively regulating Batf.J Immunol. 2013 Jan 1;190(1):58-65. doi: 10.4049/jimmunol.1200868. Epub 2012 Nov 30.
• [30] Regulatory polymorphisms in EGR2 are associated with susceptibility to systemic lupus erythematosus.Hum Mol Genet. 2010 Jun 1;19(11):2313-20. doi: 10.1093/hmg/ddq092. Epub 2010 Mar 1.
• [31] Applying minimal RNA-seq of peripheral blood platelet mRNA to reveal novel biomarkers in male patients with cerebral stroke.Neuroreport. 2020 Jan 27;31(2):156-161. doi: 10.1097/WNR.0000000000001394.
• [32] RNA sequencing identifies crucial genes in papillary thyroid carcinoma (PTC) progression.Exp Mol Pathol. 2016 Feb;100(1):151-9. doi: 10.1016/j.yexmp.2015.12.011. Epub 2015 Dec 18.
• [33] Characterization of an early growth response gene, which encodes a zinc finger transcription factor, potentially involved in cell cycle regulation.Mol Endocrinol. 1995 Nov;9(11):1610-20. doi: 10.1210/mend.9.11.8584037.
• [34] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [37] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [41] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [42] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [43] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [44] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [45] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [46] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [47] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [48] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [49] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [50] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [51] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [52] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [53] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [54] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [55] Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells. EMBO J. 2019 Jun 17;38(12):e101107. doi: 10.15252/embj.2018101107. Epub 2019 May 8.
• [56] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [57] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [58] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [59] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [60] Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
• [61] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [62] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [63] Persistent organic pollutants alter DNA methylation during human adipocyte differentiation. Toxicol In Vitro. 2017 Apr;40:79-87. doi: 10.1016/j.tiv.2016.12.011. Epub 2016 Dec 20.
• [64] Redox-sensitive regulation of gene expression in human primary macrophages exposed to inorganic arsenic. J Cell Biochem. 2009 Jun 1;107(3):537-47. doi: 10.1002/jcb.22155.