Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDPGGDV)

• DOT Name: HMG box-containing protein 1 (HBP1)
• Synonyms: HMG box transcription factor 1; High mobility group box transcription factor 1
• Gene Name: HBP1
• Related Disease:
  Arteriosclerosis
  Atherosclerosis
  Autoimmune disease
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Glioma
  Hepatitis C virus infection
  Neoplasm
  Non-small-cell lung cancer
  Oral cancer
  Osteoarthritis
  Osteosarcoma
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Chondrosarcoma
  Colon cancer
  Lung cancer
  Lung carcinoma
  Adult glioblastoma
  Advanced cancer
  Breast neoplasm
  Carcinoma
  Glioblastoma multiforme
  Invasive breast carcinoma
  Nasopharyngeal carcinoma
• UniProt ID: HBP1_HUMAN
• PDB ID: 2E6O; 3QVE
• Pfam ID: PF08517 ; PF00505
• Sequence:
  MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLP
  ELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATS
  PQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHER
  ANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARA
  EGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDH
  PFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFT
  PMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKN
  HSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEER
  RMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
• Function: Transcriptional repressor that binds to the promoter region of target genes. Plays a role in the regulation of the cell cycle and of the Wnt pathway. Binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the histone H1.0 promoter is enhanced by interaction with RB1. Disrupts the interaction between DNA and TCF4.

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[1]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[1]
Autoimmune disease	DISORMTM	Strong	Biomarker	[2]
Bone osteosarcoma	DIST1004	Strong	Genetic Variation	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
Glioma	DIS5RPEH	Strong	Biomarker	[6]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[7]
Neoplasm	DISZKGEW	Strong	Biomarker	[8]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[9]
Oral cancer	DISLD42D	Strong	Altered Expression	[8]
Osteoarthritis	DIS05URM	Strong	Biomarker	[3]
Osteosarcoma	DISLQ7E2	Strong	Genetic Variation	[3]
Prostate cancer	DISF190Y	Strong	Biomarker	[10]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[10]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[11]
Chondrosarcoma	DIS4I7JB	moderate	Genetic Variation	[3]
Colon cancer	DISVC52G	moderate	Genetic Variation	[12]
Lung cancer	DISCM4YA	moderate	Biomarker	[12]
Lung carcinoma	DISTR26C	moderate	Biomarker	[12]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[13]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[8]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[14]
Carcinoma	DISH9F1N	Limited	Biomarker	[15]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[13]
Invasive breast carcinoma	DISANYTW	Limited	Altered Expression	[14]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Altered Expression	[15]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of HMG box-containing protein 1 (HBP1).	[16]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of HMG box-containing protein 1 (HBP1).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of HMG box-containing protein 1 (HBP1).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of HMG box-containing protein 1 (HBP1).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of HMG box-containing protein 1 (HBP1).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of HMG box-containing protein 1 (HBP1).	[21]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of HMG box-containing protein 1 (HBP1).	[22]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of HMG box-containing protein 1 (HBP1).	[23]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of HMG box-containing protein 1 (HBP1).	[24]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of HMG box-containing protein 1 (HBP1).	[25]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of HMG box-containing protein 1 (HBP1).	[26]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of HMG box-containing protein 1 (HBP1).	[27]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of HMG box-containing protein 1 (HBP1).	[28]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of HMG box-containing protein 1 (HBP1).	[27]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of HMG box-containing protein 1 (HBP1).	[29]
Menadione	DMSJDTY	Approved	Menadione affects the expression of HMG box-containing protein 1 (HBP1).	[26]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of HMG box-containing protein 1 (HBP1).	[30]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of HMG box-containing protein 1 (HBP1).	[31]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of HMG box-containing protein 1 (HBP1).	[22]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of HMG box-containing protein 1 (HBP1).	[22]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of HMG box-containing protein 1 (HBP1).	[32]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of HMG box-containing protein 1 (HBP1).	[32]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of HMG box-containing protein 1 (HBP1).	[22]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of HMG box-containing protein 1 (HBP1).	[33]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of HMG box-containing protein 1 (HBP1).	[23]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of HMG box-containing protein 1 (HBP1).	[34]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of HMG box-containing protein 1 (HBP1).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of HMG box-containing protein 1 (HBP1).	[30]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of HMG box-containing protein 1 (HBP1).	[39]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of HMG box-containing protein 1 (HBP1).	[40]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of HMG box-containing protein 1 (HBP1).	[41]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of HMG box-containing protein 1 (HBP1).	[43]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of HMG box-containing protein 1 (HBP1).	[35]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of HMG box-containing protein 1 (HBP1).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of HMG box-containing protein 1 (HBP1).	[38]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of HMG box-containing protein 1 (HBP1).	[42]

References

• [1] Elevated microRNA-155 promotes foam cell formation by targeting HBP1 in atherogenesis.Cardiovasc Res. 2014 Jul 1;103(1):100-10. doi: 10.1093/cvr/cvu070. Epub 2014 Mar 27.
• [2] Genome-Wide Association Meta-Analysis Reveals Novel Juvenile Idiopathic Arthritis Susceptibility Loci.Arthritis Rheumatol. 2017 Nov;69(11):2222-2232. doi: 10.1002/art.40216. Epub 2017 Oct 12.
• [3] Functional testing of thousands of osteoarthritis-associated variants for regulatory activity.Nat Commun. 2019 Jun 4;10(1):2434. doi: 10.1038/s41467-019-10439-y.
• [4] miR-17-5p promotes human breast cancer cell migration and invasion through suppression of HBP1.Breast Cancer Res Treat. 2011 Apr;126(3):565-75. doi: 10.1007/s10549-010-0954-4. Epub 2010 May 27.
• [5] MicroRNA-155 enhances the activation of Wnt/-catenin signaling in colorectal carcinoma by suppressing HMG-box transcription factor 1.Mol Med Rep. 2016 Mar;13(3):2221-8. doi: 10.3892/mmr.2016.4788. Epub 2016 Jan 15.
• [6] miR-155 contributes to the progression of glioma by enhancing Wnt/-catenin pathway.Tumour Biol. 2015 Jul;36(7):5323-31. doi: 10.1007/s13277-015-3193-9. Epub 2015 Feb 12.
• [7] Gene expression patterns in livers of Hispanic patients infected with hepatitis C virus.Autoimmunity. 2011 Nov;44(7):532-42. doi: 10.3109/08916934.2011.592881. Epub 2011 Aug 24.
• [8] Matrix metalloproteinase-13is a target gene of high-mobility group box-containing protein 1 in modulating oral cancer cell invasion.J Cell Physiol. 2019 Apr;234(4):4375-4384. doi: 10.1002/jcp.27223. Epub 2018 Sep 7.
• [9] Long noncoding RNA actin filament-associated protein 1 antisense RNA 1 promotes malignant phenotype through binding with lysine-specific demethylase 1 and repressing HMG box-containing protein 1 in non-small-cell lung cancer.Cancer Sci. 2019 Jul;110(7):2211-2225. doi: 10.1111/cas.14039. Epub 2019 May 29.
• [10] Transcription Factor HBP1 Enhances Radiosensitivity by Inducing Apoptosis in Prostate Cancer Cell Lines.Anal Cell Pathol (Amst). 2016;2016:7015659. doi: 10.1155/2016/7015659. Epub 2016 Jan 28.
• [11] Macrophage migration inhibitory factor is a direct target of HBP1-mediated transcriptional repression that is overexpressed in prostate cancer.Oncogene. 2010 May 27;29(21):3067-78. doi: 10.1038/onc.2010.97. Epub 2010 Apr 12.
• [12] HBP1 promoter methylation augments the oncogenic -catenin to correlate with prognosis in NSCLC.J Cell Mol Med. 2014 Sep;18(9):1752-61. doi: 10.1111/jcmm.12318. Epub 2014 Jun 4.
• [13] HBP1 phosphorylation by AKT regulates its transcriptional activity and glioblastoma cell proliferation.Cell Signal. 2018 Apr;44:158-170. doi: 10.1016/j.cellsig.2018.01.014. Epub 2018 Feb 16.
• [14] Alterations of the HBP1 transcriptional repressor are associated with invasive breast cancer.Cancer Res. 2007 Jul 1;67(13):6136-45. doi: 10.1158/0008-5472.CAN-07-0567.
• [15] HMG-box transcription factor 1: a positive regulator of the G1/S transition through the Cyclin-CDK-CDKI molecular network in nasopharyngeal carcinoma.Cell Death Dis. 2018 Jan 24;9(2):100. doi: 10.1038/s41419-017-0175-4.
• [16] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [17] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [18] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [19] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [23] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [26] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [27] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [28] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [29] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [30] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [31] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [32] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [33] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [34] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [37] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [38] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [39] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [40] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [41] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [42] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [43] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.