Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEREYS5)

• DOT Name: Mitogen-activated protein kinase 8 (MAPK8)
• Synonyms: MAP kinase 8; MAPK 8; EC 2.7.11.24; JNK-46; Stress-activated protein kinase 1c; SAPK1c; Stress-activated protein kinase JNK1; c-Jun N-terminal kinase 1
• Gene Name: MAPK8
• UniProt ID: MK08_HUMAN
• PDB ID: 1UKH; 1UKI; 2G01; 2GMX; 2H96; 2NO3; 2XRW; 2XS0; 3ELJ; 3O17; 3O2M; 3PZE; 3V3V; 3VUD; 3VUG; 3VUH; 3VUI; 3VUK; 3VUL; 3VUM; 4AWI; 4E73; 4G1W; 4HYS; 4HYU; 4IZY; 4L7F; 4QTD; 4UX9; 4YR8; 5LW1; 6F5E; 6ZR5
• EC Number: 2.7.11.24
• Pfam ID: PF00069
• Sequence:
  MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
  FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
  MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
  MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
  LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
  MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
  MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
  GPLGCCR
• Function: Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as pro-inflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK8/JNK1. In turn, MAPK8/JNK1 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN, JDP2 and ATF2 and thus regulates AP-1 transcriptional activity. Phosphorylates the replication licensing factor CDT1, inhibiting the interaction between CDT1 and the histone H4 acetylase HBO1 to replication origins. Loss of this interaction abrogates the acetylation required for replication initiation. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including p53/TP53 and Yes-associates protein YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Contributes to the survival of erythroid cells by phosphorylating the antagonist of cell death BAD upon EPO stimulation. Mediates starvation-induced BCL2 phosphorylation, BCL2 dissociation from BECN1, and thus activation of autophagy. Phosphorylates STMN2 and hence regulates microtubule dynamics, controlling neurite elongation in cortical neurons. In the developing brain, through its cytoplasmic activity on STMN2, negatively regulates the rate of exit from multipolar stage and of radial migration from the ventricular zone. Phosphorylates several other substrates including heat shock factor protein 4 (HSF4), the deacetylase SIRT1, ELK1, or the E3 ligase ITCH. Phosphorylates the CLOCK-BMAL1 heterodimer and plays a role in the regulation of the circadian clock. Phosphorylates the heat shock transcription factor HSF1, suppressing HSF1-induced transcriptional activity. Phosphorylates POU5F1, which results in the inhibition of POU5F1's transcriptional activity and enhances its proteasomal degradation. Phosphorylates JUND and this phosphorylation is inhibited in the presence of MEN1. In neurons, phosphorylates SYT4 which captures neuronal dense core vesicles at synapses. Phosphorylates EIF4ENIF1/4-ET in response to oxidative stress, promoting P-body assembly. Phosphorylates SIRT6 in response to oxidative stress, stimulating its mono-ADP-ribosyltransferase activity. Phosphorylates NLRP3, promoting assembly of the NLRP3 inflammasome ; JNK1 isoforms display different binding patterns: beta-1 preferentially binds to c-Jun, whereas alpha-1, alpha-2, and beta-2 have a similar low level of binding to both c-Jun or ATF2. However, there is no correlation between binding and phosphorylation, which is achieved at about the same efficiency by all isoforms.
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  MAPK sig.ling pathway (hsa04010)
  ErbB sig.ling pathway (hsa04012)
  Ras sig.ling pathway (hsa04014)
  cAMP sig.ling pathway (hsa04024)
  FoxO sig.ling pathway (hsa04068)
  Sphingolipid sig.ling pathway (hsa04071)
  Mitophagy - animal (hsa04137)
  Autophagy - animal (hsa04140)
  Protein processing in endoplasmic reticulum (hsa04141)
  Apoptosis (hsa04210)
  Apoptosis - multiple species (hsa04215)
  Necroptosis (hsa04217)
  Wnt sig.ling pathway (hsa04310)
  Osteoclast differentiation (hsa04380)
  Focal adhesion (hsa04510)
  Tight junction (hsa04530)
  Toll-like receptor sig.ling pathway (hsa04620)
  NOD-like receptor sig.ling pathway (hsa04621)
  RIG-I-like receptor sig.ling pathway (hsa04622)
  C-type lectin receptor sig.ling pathway (hsa04625)
  IL-17 sig.ling pathway (hsa04657)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  T cell receptor sig.ling pathway (hsa04660)
  Fc epsilon RI sig.ling pathway (hsa04664)
  TNF sig.ling pathway (hsa04668)
  Neurotrophin sig.ling pathway (hsa04722)
  Retrograde endocan.binoid sig.ling (hsa04723)
  Dopaminergic sy.pse (hsa04728)
  Inflammatory mediator regulation of TRP channels (hsa04750)
  Insulin sig.ling pathway (hsa04910)
  GnRH sig.ling pathway (hsa04912)
  Progesterone-mediated oocyte maturation (hsa04914)
  Prolactin sig.ling pathway (hsa04917)
  Adipocytokine sig.ling pathway (hsa04920)
  Relaxin sig.ling pathway (hsa04926)
  Type II diabetes mellitus (hsa04930)
  Insulin resistance (hsa04931)
  Non-alcoholic fatty liver disease (hsa04932)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  Growth hormone synthesis, secretion and action (hsa04935)
  Alcoholic liver disease (hsa04936)
  Alzheimer disease (hsa05010)
  Parkinson disease (hsa05012)
  Huntington disease (hsa05016)
  Spinocerebellar ataxia (hsa05017)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120)
  Pathogenic Escherichia coli infection (hsa05130)
  Shigellosis (hsa05131)
  Salmonella infection (hsa05132)
  Pertussis (hsa05133)
  Yersinia infection (hsa05135)
  Chagas disease (hsa05142)
  Toxoplasmosis (hsa05145)
  Tuberculosis (hsa05152)
  Hepatitis B (hsa05161)
  Measles (hsa05162)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Epstein-Barr virus infection (hsa05169)
  Human immunodeficiency virus 1 infection (hsa05170)
  Coro.virus disease - COVID-19 (hsa05171)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Colorectal cancer (hsa05210)
  Pancreatic cancer (hsa05212)
  Choline metabolism in cancer (hsa05231)
  Diabetic cardiomyopathy (hsa05415)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Activation of BMF and translocation to mitochondria (R-HSA-139910)
  NRAGE signals death through JNK (R-HSA-193648)
  NRIF signals cell death from the nucleus (R-HSA-205043)
  Oxidative Stress Induced Senescence (R-HSA-2559580)
  FCERI mediated MAPK activation (R-HSA-2871796)
  DSCAM interactions (R-HSA-376172)
  JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (R-HSA-450321)
  Activation of the AP-1 family of transcription factors (R-HSA-450341)
  Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565)
  Interleukin-38 signaling (R-HSA-9007892)
  WNT5 (R-HSA-9673324)
  Activation of BIM and translocation to mitochondria (R-HSA-111446)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Mitogen-activated protein kinase 8 (MAPK8) increases the Cell death ADR of Etoposide.	[95]
Haloperidol	DM96SE0	Approved	Mitogen-activated protein kinase 8 (MAPK8) increases the Apoptosis ADR of Haloperidol.	[95]
Morphine	DMRMS0L	Approved	Mitogen-activated protein kinase 8 (MAPK8) increases the Hyperpathia ADR of Morphine.	[95]
Afimoxifene	DMFORDT	Phase 2	Mitogen-activated protein kinase 8 (MAPK8) decreases the response to substance of Afimoxifene.	[96]

50 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Mitogen-activated protein kinase 8 (MAPK8).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[5]
Arsenic	DMTL2Y1	Approved	Arsenic increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[8]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[17]
Bortezomib	DMNO38U	Approved	Bortezomib increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[18]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[19]
Ethanol	DMDRQZU	Approved	Ethanol increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[20]
Nicotine	DMWX5CO	Approved	Nicotine increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[22]
Menthol	DMG2KW7	Approved	Menthol increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[23]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[24]
Vinblastine	DM5TVS3	Approved	Vinblastine increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[25]
Colchicine	DM2POTE	Approved	Colchicine increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[25]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[27]
Gefitinib	DM15F0X	Approved	Gefitinib decreases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[28]
Glucosamine	DM4ZLFD	Approved	Glucosamine increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[30]
Mebendazole	DMO14SG	Approved	Mebendazole increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[31]
Trovafloxacin	DM6AN32	Approved	Trovafloxacin increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[32]
Efavirenz	DMC0GSJ	Approved	Efavirenz increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[33]
Sanguinarine	DMDINFS	Approved	Sanguinarine increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[35]
Stavudine	DM6DEK9	Approved	Stavudine decreases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[24]
Sorbitol	DMAN0DE	Approved	Sorbitol increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[37]
Febuxostat	DMDEXQ0	Approved	Febuxostat increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[38]
MCI-186	DM8ZHP1	Approved	MCI-186 increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[40]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[47]
Buparlisib	DM1WEHC	Phase 3	Buparlisib increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[48]
Psoralen	DMIZJ8M	Phase 3	Psoralen increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[49]
DNCB	DMDTVYC	Phase 2	DNCB increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[52]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[53]
Adaphostin	DM16QSG	Phase 1	Adaphostin increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[58]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[60]
TDZD-8	DMG6Q45	Patented	TDZD-8 increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[62]
WIN-55212-2	DMACBIW	Terminated	WIN-55212-2 increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[65]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[70]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[71]
Paraquat	DMR8O3X	Investigative	Paraquat increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[72]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[74]
D-glucose	DMMG2TO	Investigative	D-glucose increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[75]
Manganese	DMKT129	Investigative	Manganese increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[78]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[79]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[80]
acrolein	DMAMCSR	Investigative	acrolein increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[82]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[83]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[84]
Cordycepin	DM72Y01	Investigative	Cordycepin increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[85]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[86]
1,6-hexamethylene diisocyanate	DMLB3RT	Investigative	1,6-hexamethylene diisocyanate increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[87]
methylglyoxal	DMRC3OZ	Investigative	methylglyoxal increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[89]
NORCANTHARIDIN	DM9B6Y1	Investigative	NORCANTHARIDIN increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[90]
OLEANOLIC_ACID	DMWDMJ3	Investigative	OLEANOLIC_ACID decreases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[91]
CHLORANIL	DMCHGF1	Investigative	CHLORANIL increases the phosphorylation of Mitogen-activated protein kinase 8 (MAPK8).	[92]

50 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[11]
Triclosan	DMZUR4N	Approved	Triclosan affects the expression of Mitogen-activated protein kinase 8 (MAPK8).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Mitogen-activated protein kinase 8 (MAPK8).	[13]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Mitogen-activated protein kinase 8 (MAPK8).	[14]
Menadione	DMSJDTY	Approved	Menadione increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone affects the expression of Mitogen-activated protein kinase 8 (MAPK8).	[16]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[21]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Mitogen-activated protein kinase 8 (MAPK8).	[13]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[26]
Melatonin	DMKWFBT	Approved	Melatonin increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[29]
Ethacrynic acid	DM60QMR	Approved	Ethacrynic acid decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[34]
Dipyridamole	DMXY30O	Approved	Dipyridamole increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[36]
Diphenhydramine	DMKQTBA	Approved	Diphenhydramine increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[39]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[41]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[42]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[43]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[44]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[45]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[46]
EXISULIND	DMBY56U	Phase 3	EXISULIND increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[36]
Plitidepsin	DMJ8AUE	Phase 3	Plitidepsin increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[50]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[51]
Puerarin	DMJIMXH	Phase 2	Puerarin increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[54]
CP-461	DMEYMTX	Phase 2	CP-461 increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[36]
Resiniferatoxin	DMP62L5	Phase 2	Resiniferatoxin increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[55]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[56]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[57]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[59]
PMID28870136-Compound-49	DMTUC9E	Patented	PMID28870136-Compound-49 increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[61]
LY293111	DM03FHA	Discontinued in Phase 2	LY293111 increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[63]
Dioscin	DM5H2W9	Preclinical	Dioscin increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[64]
SB 203580	DMAET6F	Terminated	SB 203580 decreases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[50]
Spermine	DMD4BFY	Terminated	Spermine increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[66]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[67]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[68]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[69]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[73]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[76]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal increases the activity of Mitogen-activated protein kinase 8 (MAPK8).	[77]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[81]
LICOAGROCHACONE A	DMWY0TN	Investigative	LICOAGROCHACONE A increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[88]
Syringic Acid	DM802V7	Investigative	Syringic Acid decreases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[93]
OXYRESVERATROL	DMN7S4L	Investigative	OXYRESVERATROL increases the expression of Mitogen-activated protein kinase 8 (MAPK8).	[94]

References

• [1] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Gene expression data from acetaminophen-induced toxicity in human hepatic in vitro systems and clinical liver samples. Data Brief. 2016 Mar 26;7:1052-1057. doi: 10.1016/j.dib.2016.03.069. eCollection 2016 Jun.
• [4] Loperamide potentiates doxorubicin sensitivity in triple-negative breast cancer cells by targeting MDR1 and JNK and suppressing mTOR and Bcl-2: In vitro and molecular docking study. J Biochem Mol Toxicol. 2022 Jan;36(1):e22938. doi: 10.1002/jbt.22938. Epub 2021 Oct 31.
• [5] Cisplatin induces autophagy to enhance hepatitis B virus replication via activation of ROS/JNK and inhibition of the Akt/mTOR pathway. Free Radic Biol Med. 2019 Feb 1;131:225-236. doi: 10.1016/j.freeradbiomed.2018.12.008. Epub 2018 Dec 11.
• [6] Gene expression profiling reveals novel regulation by bisphenol-A in estrogen receptor-alpha-positive human cells. Environ Res. 2006 Jan;100(1):86-92.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Arsenic activates STAT3 signaling during the transformation of the human bronchial epithelial cells. Toxicol Appl Pharmacol. 2022 Feb 1;436:115884. doi: 10.1016/j.taap.2022.115884. Epub 2022 Jan 11.
• [9] Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
• [10] Apoptosis induced by arsenic trioxide in leukemia U937 cells is dependent on activation of p38, inactivation of ERK and the Ca2+-dependent production of superoxide. Int J Cancer. 2001 May 15;92(4):518-26. doi: 10.1002/ijc.1220.
• [11] Neuroprotective effects of glucomoringin-isothiocyanate against H(2)O(2)-Induced cytotoxicity in neuroblastoma (SH-SY5Y) cells. Neurotoxicology. 2019 Dec;75:89-104. doi: 10.1016/j.neuro.2019.09.008. Epub 2019 Sep 12.
• [12] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [13] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [14] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [15] Menadione biphasically controls JNK-linked cell death in leukemia Jurkat T cells. Antioxid Redox Signal. 2002 Jun;4(3):371-8. doi: 10.1089/15230860260196173.
• [16] Anti-diabetic effect of oligosaccharides from seaweed Sargassum confusum via JNK-IRS1/PI3K signalling pathways and regulation of gut microbiota. Food Chem Toxicol. 2019 Sep;131:110562. doi: 10.1016/j.fct.2019.110562. Epub 2019 Jun 7.
• [17] Inhibition of autophagic flux differently modulates cannabidiol-induced death in 2D and 3D glioblastoma cell cultures. Sci Rep. 2020 Feb 14;10(1):2687. doi: 10.1038/s41598-020-59468-4.
• [18] The novel polyamine analogue CGC-11093 enhances the antimyeloma activity of bortezomib. Cancer Res. 2008 Jun 15;68(12):4783-90. doi: 10.1158/0008-5472.CAN-07-6483.
• [19] Hydroquinone-induced miR-122 down-regulation elicits ADAM17 up-regulation, leading to increased soluble TNF- production in human leukemia cells with expressed Bcr/Abl. Biochem Pharmacol. 2013 Sep 1;86(5):620-31. doi: 10.1016/j.bcp.2013.06.009. Epub 2013 Jun 20.
• [20] CYP4F2 repression and a modified alpha-tocopherol (vitamin E) metabolism are two independent consequences of ethanol toxicity in human hepatocytes. Toxicol In Vitro. 2017 Apr;40:124-133.
• [21] Involvement of Asp-Glu-Val-Asp-directed, caspase-mediated mitogen-activated protein kinase kinase 1 Cleavage, c-Jun N-terminal kinase activation, and subsequent Bcl-2 phosphorylation for paclitaxel-induced apoptosis in HL-60 cells. Mol Pharmacol. 2001 Feb;59(2):254-62. doi: 10.1124/mol.59.2.254.
• [22] Nicotine-induced survival signaling in lung cancer cells is dependent on their p53 status while its down-regulation by curcumin is independent. Mol Cancer. 2010 Aug 20;9:220.
• [23] Menthol regulates TRPM8-independent processes in PC-3 prostate cancer cells. Biochim Biophys Acta. 2009 Jan;1792(1):33-8. doi: 10.1016/j.bbadis.2008.09.012. Epub 2008 Oct 9.
• [24] Lon protease and eiF2 are involved in acute, but not prolonged, antiretroviral induced stress response in HepG2 cells. Chem Biol Interact. 2016 May 25;252:82-6. doi: 10.1016/j.cbi.2016.03.021. Epub 2016 Apr 1.
• [25] Nocodazole-induced p53-dependent c-Jun N-terminal kinase activation reduces apoptosis in human colon carcinoma HCT116 cells. J Biol Chem. 2002 Nov 15;277(46):43648-58. doi: 10.1074/jbc.M203214200. Epub 2002 Sep 6.
• [26] Roles of JNK-1 and p38 in selective induction of apoptosis by capsaicin in ras-transformed human breast epithelial cells. Int J Cancer. 2003 Feb 10;103(4):475-82. doi: 10.1002/ijc.10855.
• [27] Synergistic antimetastatic effect of cotreatment with licochalcone A and sorafenib on human hepatocellular carcinoma cells through the inactivation of MKK4/JNK and uPA expression. Environ Toxicol. 2018 Dec;33(12):1237-1244. doi: 10.1002/tox.22630. Epub 2018 Sep 6.
• [28] Frankincense myrrh attenuates hepatocellular carcinoma by regulating tumor blood vessel development through multiple epidermal growth factor receptor-mediated signaling pathways. World J Gastrointest Oncol. 2022 Feb 15;14(2):450-477. doi: 10.4251/wjgo.v14.i2.450.
• [29] Melatonin induces cell cycle arrest and apoptosis in hepatocarcinoma HepG2 cell line. J Pineal Res. 2008 Nov;45(4):532-40. doi: 10.1111/j.1600-079X.2008.00641.x.
• [30] Disease-modifying effects of glucosamine HCl involving regulation of metalloproteinases and chemokines activated by interleukin-1beta in human primary synovial fibroblasts. J Cell Biochem. 2008 May 1;104(1):38-50. doi: 10.1002/jcb.21597.
• [31] Stimulation of pro-inflammatory responses by mebendazole in human monocytic THP-1 cells through an ERK signaling pathway. Arch Toxicol. 2011 Mar;85(3):199-207. doi: 10.1007/s00204-010-0584-y. Epub 2010 Sep 17.
• [32] TNF enhances trovafloxacin-induced in vitro hepatotoxicity by inhibiting protective autophagy. Toxicol Lett. 2021 May 15;342:73-84. doi: 10.1016/j.toxlet.2021.02.009. Epub 2021 Feb 17.
• [33] Efavirenz and 8-hydroxyefavirenz induce cell death via a JNK- and BimEL-dependent mechanism in primary human hepatocytes. Toxicol Appl Pharmacol. 2011 Dec 1;257(2):227-34. doi: 10.1016/j.taap.2011.09.008. Epub 2011 Sep 19.
• [34] Characterization of cell death induced by ethacrynic acid in a human colon cancer cell line DLD-1 and suppression by N-acetyl-L-cysteine. Cancer Sci. 2003 Oct;94(10):886-93.
• [35] Sanguinarine induces apoptosis in A549 human lung cancer cells primarily via cellular glutathione depletion. Toxicol In Vitro. 2009 Mar;23(2):281-7. doi: 10.1016/j.tiv.2008.12.013. Epub 2008 Dec 24.
• [36] Cyclic GMP mediates apoptosis induced by sulindac derivatives via activation of c-Jun NH2-terminal kinase 1. Clin Cancer Res. 2000 Oct;6(10):4136-41.
• [37] Intracellular mobility and nuclear trafficking of the stress-activated kinase JNK1 are impeded by hyperosmotic stress. Biochim Biophys Acta. 2014 Feb;1843(2):253-64. doi: 10.1016/j.bbamcr.2013.10.017. Epub 2013 Nov 1.
• [38] Febuxostat Increases Ventricular Arrhythmogenesis Through Calcium Handling Dysregulation in Human-Induced Pluripotent Stem Cell-Derived Cardiomyocytes. Toxicol Sci. 2022 Sep 24;189(2):216-224. doi: 10.1093/toxsci/kfac073.
• [39] First-generation antihistamines diphenhydramine and chlorpheniramine reverse cytokine-afforded eosinophil survival by enhancing apoptosis. Allergy Asthma Proc. 2007 Jan-Feb;28(1):79-86. doi: 10.2500/aap.2007.28.2961.
• [40] Edaravone improves the expression of nerve growth factor in human astrocytes subjected to hypoxia/reoxygenation. Neurosci Res. 2010 Mar;66(3):284-9. doi: 10.1016/j.neures.2009.11.011. Epub 2009 Nov 30.
• [41] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [42] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [43] Resveratrol inhibits phorbol ester and UV-induced activator protein 1 activation by interfering with mitogen-activated protein kinase pathways. Mol Pharmacol. 2001 Jul;60(1):217-24. doi: 10.1124/mol.60.1.217.
• [44] Low dose epigallocatechin-3-gallate revives doxorubicin responsiveness by a redox-sensitive pathway in A549 lung adenocarcinoma cells. J Biochem Mol Toxicol. 2022 Apr;36(4):e22999. doi: 10.1002/jbt.22999. Epub 2022 Feb 26.
• [45] Expression profiles of apoptotic genes induced by curcumin in human breast cancer and mammary epithelial cell lines. Anticancer Res. 2005 Sep-Oct;25(5):3293-302.
• [46] N-(4-hydroxyphenyl)retinamide-induced apoptosis triggered by reactive oxygen species is mediated by activation of MAPKs in head and neck squamous carcinoma cells. Oncogene. 2006 May 4;25(19):2785-94. doi: 10.1038/sj.onc.1209303.
• [47] Camptothecin induces mitotic arrest through Mad2-Cdc20 complex by activating the JNK-mediated Sp1 pathway. Food Chem Toxicol. 2019 May;127:143-155. doi: 10.1016/j.fct.2019.03.026. Epub 2019 Mar 15.
• [48] Combination PI3K/MEK inhibition promotes tumor apoptosis and regression in PIK3CA wild-type, KRAS mutant colorectal cancer. Cancer Lett. 2014 Jun 1;347(2):204-11. doi: 10.1016/j.canlet.2014.02.018. Epub 2014 Feb 24.
• [49] Psoralen induces hepatic toxicity through PERK and ATF6 related ER stress pathways in HepG2 cells. Toxicol Mech Methods. 2020 Jan;30(1):39-47. doi: 10.1080/15376516.2019.1650150. Epub 2019 Aug 20.
• [50] Plitidepsin has a dual effect inhibiting cell cycle and inducing apoptosis via Rac1/c-Jun NH2-terminal kinase activation in human melanoma cells. J Pharmacol Exp Ther. 2008 Mar;324(3):1093-101. doi: 10.1124/jpet.107.132662. Epub 2007 Dec 18.
• [51] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [52] Characterization of early events involved in human dendritic cell maturation induced by sensitizers: cross talk between MAPK signalling pathways. Toxicol Appl Pharmacol. 2008 Aug 1;230(3):397-406. doi: 10.1016/j.taap.2008.03.012. Epub 2008 Apr 8.
• [53] Radiofrequency radiation does not induce stress response in human T-lymphocytes and rat primary astrocytes. Bioelectromagnetics. 2006 Oct;27(7):578-88. doi: 10.1002/bem.20235.
• [54] [Apoptosis of NB4 cells induced by flavonoids of puerarin in vitro]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2010 Apr;18(2):326-9.
• [55] Induction of apoptosis by vanilloid compounds does not require de novo gene transcription and activator protein 1 activity. Cell Growth Differ. 1998 Mar;9(3):277-86.
• [56] Gaseous nitrogen oxide repressed benzo[a]pyrene-induced human lung fibroblast cell apoptosis via inhibiting JNK1 signals. Arch Toxicol. 2005 Dec;79(12):694-704. doi: 10.1007/s00204-005-0001-0. Epub 2005 Jul 22.
• [57] Identification of a novel BET bromodomain inhibitor-sensitive, gene regulatory circuit that controls Rituximab response and tumour growth in aggressive lymphoid cancers. EMBO Mol Med. 2013 Aug;5(8):1180-95. doi: 10.1002/emmm.201202034. Epub 2013 Jul 4.
• [58] Induction of apoptosis in human leukemia cells by the tyrosine kinase inhibitor adaphostin proceeds through a RAF-1/MEK/ERK- and AKT-dependent process. Oncogene. 2004 Feb 19;23(7):1364-76. doi: 10.1038/sj.onc.1207248.
• [59] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [60] Luteolin induced G2 phase cell cycle arrest and apoptosis on non-small cell lung cancer cells. Toxicol In Vitro. 2011 Oct;25(7):1385-91. doi: 10.1016/j.tiv.2011.05.009. Epub 2011 May 13.
• [61] Pentoxifylline augments TRAIL/Apo2L mediated apoptosis in cutaneous T cell lymphoma (HuT-78 and MyLa) by modulating the expression of antiapoptotic proteins and death receptors. Biochem Pharmacol. 2010 Dec 1;80(11):1650-61. doi: 10.1016/j.bcp.2010.08.018. Epub 2010 Sep 8.
• [62] Forecasting cell death dose-response from early signal transduction responses in vitro. Toxicol Sci. 2014 Aug 1;140(2):338-51. doi: 10.1093/toxsci/kfu089. Epub 2014 May 13.
• [63] Leukotriene B4 receptor inhibitor LY293111 induces cell cycle arrest and apoptosis in human anaplastic large-cell lymphoma cells via JNK phosphorylation. Leukemia. 2005 Nov;19(11):1977-84. doi: 10.1038/sj.leu.2403929.
• [64] Molecular mechanism and inhibitory targets of dioscin in HepG2 cells. Food Chem Toxicol. 2018 Oct;120:143-154.
• [65] Epidermal growth factor receptor transactivation by the cannabinoid receptor (CB1) and transient receptor potential vanilloid 1 (TRPV1) induces differential responses in corneal epithelial cells. Exp Eye Res. 2010 Sep;91(3):462-71. doi: 10.1016/j.exer.2010.06.022. Epub 2010 Jul 7.
• [66] Inhibition of apoptotic signalling in spermine-treated vascular smooth muscle cells by a novel glutathione precursor. Cell Biol Int. 2010 Apr 1;34(5):503-11.
• [67] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [68] Epigenetic changes and disturbed neural development in a human embryonic stem cell-based model relating to the fetal valproate syndrome. Hum Mol Genet. 2012 Sep 15;21(18):4104-14. doi: 10.1093/hmg/dds239. Epub 2012 Jun 20.
• [69] Involvement of c-Jun N-terminal kinase in G2/M arrest and caspase-mediated apoptosis induced by sulforaphane in DU145 prostate cancer cells. Nutr Cancer. 2005;52(2):213-24. doi: 10.1207/s15327914nc5202_11.
• [70] Hesperidin inhibited acetaldehyde-induced matrix metalloproteinase-9 gene expression in human hepatocellular carcinoma cells. Toxicol Lett. 2009 Feb 10;184(3):204-10.
• [71] Ochratoxin A exerts neurotoxicity in human astrocytes through mitochondria-dependent apoptosis and intracellular calcium overload. Toxicol Lett. 2019 Oct 1;313:42-49. doi: 10.1016/j.toxlet.2019.05.021. Epub 2019 May 30.
• [72] JNK Inhibitor SP600125 Attenuates Paraquat-Induced Acute Lung Injury: an In Vivo and In Vitro Study. Inflammation. 2017 Aug;40(4):1319-1330. doi: 10.1007/s10753-017-0575-8.
• [73] Use of human neuroblastoma SH-SY5Y cells to evaluate glyphosate-induced effects on oxidative stress, neuronal development and cell death signaling pathways. Environ Int. 2020 Feb;135:105414. doi: 10.1016/j.envint.2019.105414. Epub 2019 Dec 23.
• [74] Capsaicin attenuates palmitate-induced expression of macrophage inflammatory protein 1 and interleukin 8 by increasing palmitate oxidation and reducing c-Jun activation in THP-1 (human acute monocytic leukemia cell) cells. Nutr Res. 2011 Jun;31(6):468-78. doi: 10.1016/j.nutres.2011.05.007. Epub 2011 Jun 17.
• [75] Rutaecarpine attenuates high glucose-induced damage in AC16 cardiomyocytes by suppressing the MAPK pathway. J Appl Toxicol. 2023 Sep;43(9):1306-1318. doi: 10.1002/jat.4465. Epub 2023 Mar 29.
• [76] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
• [77] Transfection of mGSTA4 in HL-60 cells protects against 4-hydroxynonenal-induced apoptosis by inhibiting JNK-mediated signaling. Arch Biochem Biophys. 2001 Aug 15;392(2):197-207. doi: 10.1006/abbi.2001.2452.
• [78] Activation of MAP kinases by hexavalent chromium, manganese and nickel in human lung epithelial cells. Toxicol Lett. 2006 Dec 1;167(2):114-21. doi: 10.1016/j.toxlet.2006.08.015. Epub 2006 Sep 9.
• [79] Oxidative stress plays a key role in butyrate-mediated autophagy via Akt/mTOR pathway in hepatoma cells. Chem Biol Interact. 2017 Aug 1;273:99-106. doi: 10.1016/j.cbi.2017.06.001. Epub 2017 Jun 12.
• [80] Cinnamaldehyde enhances Nrf2 nuclear translocation to upregulate phase II detoxifying enzyme expression in HepG2 cells. J Agric Food Chem. 2011 May 11;59(9):5164-71. doi: 10.1021/jf200579h. Epub 2011 Apr 15.
• [81] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [82] Acrolein induces activation of the epidermal growth factor receptor of human keratinocytes for cell death. J Cell Biochem. 2001;81(4):679-88. doi: 10.1002/jcb.1105.
• [83] Inhibition of PP2A and the consequent activation of JNK/c-Jun are involved in tributyltin-induced apoptosis in human amnionic cells. Environ Toxicol. 2013 Jul;28(7):390-400. doi: 10.1002/tox.20730. Epub 2011 May 27.
• [84] Differential proinflammatory responses induced by diesel exhaust particles with contrasting PAH and metal content. Environ Toxicol. 2015 Feb;30(2):188-96. doi: 10.1002/tox.21884. Epub 2013 Jul 31.
• [85] [Cordycepin inhibits the proliferation and migration of human gastric cancer cells by suppressing lipid metabolism via AMPK and MAPK activation]. Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2022 Jun;38(6):513-521.
• [86] Kaempferol suppresses cell migration through the activation of the ERK signaling pathways in ARPE-19 cells. Environ Toxicol. 2019 Mar;34(3):312-318. doi: 10.1002/tox.22686. Epub 2018 Nov 30.
• [87] Contact dermatitis: in pursuit of sensitizer's molecular targets through proteomics. Arch Toxicol. 2017 Feb;91(2):811-825. doi: 10.1007/s00204-016-1714-y. Epub 2016 Apr 29.
• [88] Licochalcone A from licorice root, an inhibitor of human hepatoma cell growth via induction of cell apoptosis and cell cycle arrest. Food Chem Toxicol. 2018 Oct;120:407-417. doi: 10.1016/j.fct.2018.07.044. Epub 2018 Jul 25.
• [89] Neuroprotective effect of sulforaphane against methylglyoxal cytotoxicity. Chem Res Toxicol. 2015 Jun 15;28(6):1234-45. doi: 10.1021/acs.chemrestox.5b00067. Epub 2015 May 11.
• [90] Norcantharidin induces apoptosis of breast cancer cells: involvement of activities of mitogen activated protein kinases and signal transducers and activators of transcription. Toxicol In Vitro. 2011 Apr;25(3):699-707. doi: 10.1016/j.tiv.2011.01.011. Epub 2011 Jan 23.
• [91] SZC015, a synthetic oleanolic acid derivative, induces both apoptosis and autophagy in MCF-7 breast cancer cells. Chem Biol Interact. 2016 Jan 25;244:94-104. doi: 10.1016/j.cbi.2015.11.013. Epub 2015 Nov 21.
• [92] Tetrachlorobenzoquinone induces Nrf2 activation via rapid Bach1 nuclear export/ubiquitination and JNK-P62 signaling. Toxicology. 2016 Jul 1;363-364:48-57. doi: 10.1016/j.tox.2016.07.002. Epub 2016 Jul 5.
• [93] Syringic acid regulates suppression of the STAT3/JNK/AKT pathway via inhibition of human ovarian teratoma cancer cell?(PA-1) growth-in vitro study. J Biochem Mol Toxicol. 2021 Jun;35(6):1-9. doi: 10.1002/jbt.22776. Epub 2021 Mar 23.
• [94] Oxyresveratrol improves tight junction integrity through the PKC and MAPK signaling pathways in Caco-2?cells. Food Chem Toxicol. 2017 Oct;108(Pt A):203-213. doi: 10.1016/j.fct.2017.08.002. Epub 2017 Aug 2.
• [95] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [96] High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.