Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFNUZ7O)

DOT Name	Long-wave-sensitive opsin 1 (OPN1LW)
Synonyms	Red cone photoreceptor pigment; Red-sensitive opsin; ROP
Gene Name	OPN1LW
Related Disease	Blue cone monochromacy ( ) Intellectual disability ( ) leukaemia ( ) Osteosarcoma ( ) Rheumatoid arthritis ( ) Rubinstein-Taybi syndrome ( ) Acute leukaemia ( ) Acute lymphocytic leukaemia ( ) Acute myelomonocytic leukemia M4 ( ) Advanced cancer ( ) Alzheimer disease ( ) Bladder cancer ( ) Bronchopulmonary dysplasia ( ) Colon cancer ( ) Colon carcinoma ( ) Colorectal carcinoma ( ) Cone-rod dystrophy 2 ( ) Esophageal squamous cell carcinoma ( ) Hepatocellular carcinoma ( ) High blood pressure ( ) Huntington disease ( ) Leukemia ( ) Neoplasm ( ) Prostate cancer ( ) Prostate carcinoma ( ) Red color blindness ( ) Squamous cell carcinoma ( ) Status epilepticus seizure ( ) Thyroid gland papillary carcinoma ( ) Type-1/2 diabetes ( ) Ulcerative colitis ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Lung adenocarcinoma ( ) Lung cancer ( ) Lung carcinoma ( ) Cone-rod dystrophy ( ) Childhood acute lymphoblastic leukemia ( ) Acute myelogenous leukaemia ( ) Breast cancer ( ) Breast carcinoma ( ) Gastric cancer ( ) Melanoma ( ) Non-small-cell lung cancer ( ) Rett syndrome ( ) Rothmund-Thomson syndrome ( ) Stomach cancer ( )
UniProt ID	OPSR_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00001
Sequence	MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM IFVVTASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFV LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCIIPLAIIMLCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVCWGPYTFFACFAAANPGYAFH PLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS VSPA
Function	Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Tissue Specificity	The three color pigments are found in the cone photoreceptor cells.
Reactome Pathway	Retinoid cycle disease events (R-HSA-2453864 ) G alpha (i) signalling events (R-HSA-418594 ) Opsins (R-HSA-419771 ) The retinoid cycle in cones (daylight vision) (R-HSA-2187335 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Blue cone monochromacy	DISYV7KB	Definitive	X-linked	[1]
Intellectual disability	DISMBNXP	Definitive	Genetic Variation	[2]
leukaemia	DISS7D1V	Definitive	Genetic Variation	[3]
Osteosarcoma	DISLQ7E2	Definitive	Biomarker	[4]
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[5]
Rubinstein-Taybi syndrome	DISVF1HM	Definitive	Biomarker	[6]
Acute leukaemia	DISDQFDI	Strong	Genetic Variation	[7]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[8]
Acute myelomonocytic leukemia M4	DISRRMV2	Strong	Genetic Variation	[9]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[10]
Alzheimer disease	DISF8S70	Strong	Biomarker	[11]
Bladder cancer	DISUHNM0	Strong	Biomarker	[12]
Bronchopulmonary dysplasia	DISO0BY5	Strong	Genetic Variation	[13]
Colon cancer	DISVC52G	Strong	Biomarker	[14]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[14]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[15]
Cone-rod dystrophy 2	DISX2RWY	Strong	GermlineCausalMutation	[16]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[18]
High blood pressure	DISY2OHH	Strong	Biomarker	[19]
Huntington disease	DISQPLA4	Strong	Altered Expression	[20]
Leukemia	DISNAKFL	Strong	Genetic Variation	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Red color blindness	DISQHW4Z	Strong	X-linked	[23]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[24]
Status epilepticus seizure	DISY3BIC	Strong	Altered Expression	[25]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[26]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[27]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[28]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[12]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[12]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[29]
Lung cancer	DISCM4YA	moderate	Biomarker	[30]
Lung carcinoma	DISTR26C	moderate	Biomarker	[30]
Cone-rod dystrophy	DISY9RWN	Supportive	Autosomal dominant	[16]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Disputed	Altered Expression	[3]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[31]
Breast cancer	DIS7DPX1	Limited	Biomarker	[32]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[32]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[33]
Melanoma	DIS1RRCY	Limited	Biomarker	[34]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Altered Expression	[35]
Rett syndrome	DISGG5UV	Limited	Biomarker	[36]
Rothmund-Thomson syndrome	DISGVBCV	Limited	Biomarker	[36]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[33]
------------------------------------------------------------------------------------


⏷ Show the Full List of 47 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Long-wave-sensitive opsin 1 (OPN1LW).	[37]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Long-wave-sensitive opsin 1 (OPN1LW).	[38]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Long-wave-sensitive opsin 1 (OPN1LW).	[39]
------------------------------------------------------------------------------------

References

1	Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
2	The transcriptional coactivator and histone acetyltransferase CBP regulates neural precursor cell development and migration.Acta Neuropathol Commun. 2019 Dec 5;7(1):199. doi: 10.1186/s40478-019-0849-5.
3	Small-molecule inhibition of CBP/catenin interactions eliminates drug-resistant clones in acute lymphoblastic leukemia.Oncogene. 2014 Apr 24;33(17):2169-78. doi: 10.1038/onc.2013.169. Epub 2013 Jun 3.
4	Ras-ERK1/2 Signaling Promotes The Development Of Osteosarcoma By Regulating H2BK12ac Through CBP.Cancer Manag Res. 2019 Oct 24;11:9153-9163. doi: 10.2147/CMAR.S219535. eCollection 2019.
5	TNF- induces expression of the circadian clock gene Bmal1 via dual calcium-dependent pathways in rheumatoid synovial cells.Biochem Biophys Res Commun. 2018 Jan 8;495(2):1675-1680. doi: 10.1016/j.bbrc.2017.12.015. Epub 2017 Dec 5.
6	Mutations in CREBBP and EP300 genes affect DNA repair of oxidative damage in Rubinstein-Taybi syndrome cells.Carcinogenesis. 2020 May 14;41(3):257-266. doi: 10.1093/carcin/bgz149.
7	SN-1, a novel leukemic cell line with t(11;16)(q23;p13): myeloid characteristics and resistance to retinoids and vitamin D3.Cancer Res. 2000 Feb 15;60(4):1139-45.
8	CBP Modulates Sensitivity to Dasatinib in Pre-BCR(+) Acute Lymphoblastic Leukemia.Cancer Res. 2018 Nov 15;78(22):6497-6508. doi: 10.1158/0008-5472.CAN-18-1703. Epub 2018 Sep 27.
9	RT-PCR and FISH analysis of acute myeloid leukemia with t(8;16)(p11;p13) and chimeric MOZ and CBP transcripts: breakpoint cluster region and clinical implications.Leukemia. 2004 Jun;18(6):1115-21. doi: 10.1038/sj.leu.2403353.
10	Combination Targeting of the Bromodomain and Acetyltransferase Active Site of p300/CBP.Biochemistry. 2019 Apr 23;58(16):2133-2143. doi: 10.1021/acs.biochem.9b00160. Epub 2019 Apr 11.
11	A-induced degradation of BMAL1 and CBP leads to circadian rhythm disruption in Alzheimer's disease.Mol Neurodegener. 2015 Mar 19;10:13. doi: 10.1186/s13024-015-0007-x.
12	A CRISPR Interference of CBP and p300 Selectively Induced Synthetic Lethality in Bladder Cancer Cells In Vitro.Int J Biol Sci. 2019 May 11;15(6):1276-1286. doi: 10.7150/ijbs.32332. eCollection 2019.
13	Early red cell transfusion is associated with development of severe retinopathy of prematurity.J Perinatol. 2019 Mar;39(3):393-400. doi: 10.1038/s41372-018-0274-9. Epub 2018 Nov 20.
14	Interactions between XIAP associated factor 1 and a nuclear co-activator, CBP, in colon cancer cells.Digestion. 2008;77(2):79-86. doi: 10.1159/000121441. Epub 2008 Mar 21.
15	Aberrant activation of CYR61 enhancers in colorectal cancer development.J Exp Clin Cancer Res. 2019 May 22;38(1):213. doi: 10.1186/s13046-019-1217-9.
16	X-linked cone dystrophy caused by mutation of the red and green cone opsins. Am J Hum Genet. 2010 Jul 9;87(1):26-39. doi: 10.1016/j.ajhg.2010.05.019. Epub 2010 Jun 24.
17	A novel long noncoding RNA linc00460 up-regulated by CBP/P300 promotes carcinogenesis in esophageal squamous cell carcinoma.Biosci Rep. 2017 Oct 17;37(5):BSR20171019. doi: 10.1042/BSR20171019. Print 2017 Oct 31.
18	Inhibition of the Wnt/-catenin signaling pathway improves the anti-tumor effects of sorafenib against hepatocellular carcinoma.Cancer Lett. 2016 Oct 10;381(1):58-66. doi: 10.1016/j.canlet.2016.07.013. Epub 2016 Jul 16.
19	Morbidity After Cardiac Surgery in Patients With Adult Congenital Heart Disease in Comparison With Acquired Disease.Heart Lung Circ. 2018 Jun;27(6):739-744. doi: 10.1016/j.hlc.2017.05.133. Epub 2017 Jun 28.
20	Neuroprotective effects of psychotropic drugs in Huntington's disease.Int J Mol Sci. 2013 Nov 15;14(11):22558-603. doi: 10.3390/ijms141122558.
21	Garcinol inhibits esophageal cancer metastasis by suppressing the p300 and TGF-1 signaling pathways.Acta Pharmacol Sin. 2020 Jan;41(1):82-92. doi: 10.1038/s41401-019-0271-3. Epub 2019 Aug 1.
22	The novel BET-CBP/p300 dual inhibitor NEO2734 is active in SPOP mutant and wild-type prostate cancer.EMBO Mol Med. 2019 Nov 7;11(11):e10659. doi: 10.15252/emmm.201910659. Epub 2019 Sep 26.
23	Spectrum of color gene deletions and phenotype in patients with blue cone monochromacy. Hum Genet. 2000 Jul;107(1):75-82. doi: 10.1007/s004390000338.
24	Overexpression of retinoic acid receptor beta induces growth arrest and apoptosis in oral cancer cell lines.Jpn J Cancer Res. 2001 Jan;92(1):42-50. doi: 10.1111/j.1349-7006.2001.tb01046.x.
25	The Epigenetic Factor CBP Is Required for the Differentiation and Function of Medial Ganglionic Eminence-Derived Interneurons.Mol Neurobiol. 2019 Jun;56(6):4440-4454. doi: 10.1007/s12035-018-1382-4. Epub 2018 Oct 17.
26	CITED1 promotes proliferation of papillary thyroid cancer cells via the regulation of p21 and p27.Cell Biosci. 2018 Nov 6;8:57. doi: 10.1186/s13578-018-0256-9. eCollection 2018.
27	Insulin Downregulates the Transcriptional Coregulator CITED2, an Inhibitor of Proangiogenic Function in Endothelial Cells.Diabetes. 2016 Dec;65(12):3680-3690. doi: 10.2337/db16-0001. Epub 2016 Aug 25.
28	Chk1 Promotes DNA Damage Response Bypass following Oxidative Stress in a Model of Hydrogen Peroxide-Associated Ulcerative Colitis through JNK Inactivation and Chromatin Binding.Oxid Med Cell Longev. 2017;2017:9303158. doi: 10.1155/2017/9303158. Epub 2017 Jun 7.
29	GATA3 acetylation at K119 by CBP inhibits cell migration and invasion in lung adenocarcinoma.Biochem Biophys Res Commun. 2018 Mar 4;497(2):633-638. doi: 10.1016/j.bbrc.2018.02.120. Epub 2018 Feb 14.
30	Linking functions: an additional role for an intrinsically disordered linker domain in the transcriptional coactivator CBP.Sci Rep. 2017 Jul 5;7(1):4676. doi: 10.1038/s41598-017-04611-x.
31	Transcriptional regulators CITED2 and PU.1 cooperate in maintaining hematopoietic stem cells.Exp Hematol. 2019 May;73:38-49.e7. doi: 10.1016/j.exphem.2019.03.003. Epub 2019 Apr 13.
32	Small molecule nAS-E targeting cAMP response element binding protein (CREB) and CREB-binding protein interaction inhibits breast cancer bone metastasis.J Cell Mol Med. 2019 Feb;23(2):1224-1234. doi: 10.1111/jcmm.14024. Epub 2018 Nov 20.
33	Down-regulation of a pro-apoptotic pathway regulated by PCAF/ADA3 in early stage gastric cancer.Cell Death Dis. 2018 May 1;9(5):442. doi: 10.1038/s41419-018-0470-8.
34	A pro-apoptotic function of iASPP by stabilizing p300 and CBP through inhibition of BRMS1 E3 ubiquitin ligase activity.Cell Death Dis. 2015 Feb 12;6(2):e1634. doi: 10.1038/cddis.2015.17.
35	Transcription factor E2F-1 acts as a growth-promoting factor and is associated with adverse prognosis in non-small cell lung carcinomas.J Pathol. 2002 Oct;198(2):142-56. doi: 10.1002/path.1121.
36	Mutation of the CH1 Domain in the Histone Acetyltransferase CREBBP Results in Autism-Relevant Behaviors in Mice.PLoS One. 2016 Jan 5;11(1):e0146366. doi: 10.1371/journal.pone.0146366. eCollection 2016.
37	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
38	Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
39	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.