General Information of Drug Off-Target (DOT) (ID: OTGES2OU)

DOT Name Dynein axonemal heavy chain 8 (DNAH8)
Synonyms Axonemal beta dynein heavy chain 8; Ciliary dynein heavy chain 8
Gene Name DNAH8
Related Disease
Coeliac disease ( )
Type-1 diabetes ( )
Advanced cancer ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Bipolar disorder ( )
Breast neoplasm ( )
Cardiac disease ( )
Cardiac failure ( )
Cardiomyopathy ( )
Cocaine addiction ( )
Cytomegalovirus infection ( )
Depression ( )
Dilated cardiomyopathy 1A ( )
Drug dependence ( )
Duchenne muscular dystrophy ( )
Epilepsy ( )
Epithelial ovarian cancer ( )
Fatty liver disease ( )
Melanoma ( )
Myopathy ( )
Narcolepsy ( )
Neuralgia ( )
Non-small-cell lung cancer ( )
Obesity ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pulmonary fibrosis ( )
Spermatogenic failure 46 ( )
Substance abuse ( )
Substance dependence ( )
Plasmodium falciparum malaria ( )
Spermatogenic failure 5 ( )
Type-1/2 diabetes ( )
Breast cancer ( )
Breast carcinoma ( )
Primary ciliary dyskinesia ( )
Alzheimer disease ( )
Congestive heart failure ( )
Corpus callosum, agenesis of ( )
Hepatocellular carcinoma ( )
Neoplasm ( )
Neuroblastoma ( )
Renal fibrosis ( )
Rheumatoid arthritis ( )
Temporal lobe epilepsy ( )
UniProt ID
DYH8_HUMAN
Pfam ID
PF12774 ; PF12775 ; PF12780 ; PF12781 ; PF17857 ; PF18198 ; PF08385 ; PF08393 ; PF17852 ; PF18199 ; PF03028 ; PF12777
Sequence
MMKLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLAN
IFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNF
SKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWK
RMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTL
EKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAY
ITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFG
KFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRT
EFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTI
ERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNSD
ILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVN
FDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSV
FVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHID
TVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIFEQ
IYEVKYTGKVGKQSEQRKHVVFGSETGEGENNDYEANIVNEFDTHDKEDEFKKECKEVFA
FFSHQLLDSLQKATRLSLDTMKRRIFVASLYGRKQSEDIISFIKSEVHLAIPNVVMIPSL
DDIQQAINRMIQLTLEVSRGVAHWGQQQIRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF
EEAIPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDV
KVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWK
MLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTL
GPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLES
VEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGL
PVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCR
KLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSF
CLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLK
GTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVY
LEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHE
QLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTF
HAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDS
GFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQT
THDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVS
ITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMG
RCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLT
ARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQII
MRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPE
DSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEG
LINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPK
AITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLD
DNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLK
KRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGV
SCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVT
DYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGT
AKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTV
FIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRN
DIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLW
QWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRF
ITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKI
YELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVG
VGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDS
EIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFIS
RSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIV
CSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFI
NEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIK
NEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPP
HLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINE
ETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGR
LAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGL
SGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKI
PFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIK
SKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTF
KVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTE
KQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEV
SEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSM
ARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREF
QALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDK
DAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKT
WEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGG
WVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQ
GVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSA
DFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEK
MFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLET
ITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQ
EIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLG
FWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHN
EVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINST
APKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK
Function
Force generating protein component of the outer dynein arms (ODAs) in the sperm flagellum. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly.
Tissue Specificity Expressed in spermatozoa (at protein level). Not detected in airway epithelial cells (at protein level).
KEGG Pathway
Motor proteins (hsa04814 )
Amyotrophic lateral sclerosis (hsa05014 )
Huntington disease (hsa05016 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Coeliac disease DISIY60C Definitive Biomarker [1]
Type-1 diabetes DIS7HLUB Definitive Genetic Variation [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Arteriosclerosis DISK5QGC Strong Biomarker [3]
Atherosclerosis DISMN9J3 Strong Biomarker [3]
Bipolar disorder DISAM7J2 Strong Biomarker [4]
Breast neoplasm DISNGJLM Strong Biomarker [5]
Cardiac disease DISVO1I5 Strong Biomarker [6]
Cardiac failure DISDC067 Strong Biomarker [7]
Cardiomyopathy DISUPZRG Strong Biomarker [8]
Cocaine addiction DISHTRXG Strong Biomarker [9]
Cytomegalovirus infection DISCEMGC Strong Altered Expression [10]
Depression DIS3XJ69 Strong Genetic Variation [11]
Dilated cardiomyopathy 1A DIS0RK9Z Strong Altered Expression [12]
Drug dependence DIS9IXRC Strong Biomarker [13]
Duchenne muscular dystrophy DISRQ3NV Strong Biomarker [14]
Epilepsy DISBB28L Strong Genetic Variation [15]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [16]
Fatty liver disease DIS485QZ Strong Biomarker [3]
Melanoma DIS1RRCY Strong Altered Expression [17]
Myopathy DISOWG27 Strong Genetic Variation [18]
Narcolepsy DISLCNLI Strong Genetic Variation [19]
Neuralgia DISWO58J Strong Biomarker [20]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [21]
Obesity DIS47Y1K Strong Biomarker [22]
Ovarian cancer DISZJHAP Strong Altered Expression [16]
Ovarian neoplasm DISEAFTY Strong Altered Expression [16]
Pulmonary fibrosis DISQKVLA Strong Biomarker [23]
Spermatogenic failure 46 DISU4WQ1 Strong Autosomal recessive [24]
Substance abuse DIS327VW Strong Biomarker [13]
Substance dependence DISDRAAR Strong Biomarker [13]
Plasmodium falciparum malaria DIS3Q9KF moderate Genetic Variation [25]
Spermatogenic failure 5 DIS2U2A0 Moderate Autosomal recessive [26]
Type-1/2 diabetes DISIUHAP moderate Biomarker [27]
Breast cancer DIS7DPX1 Disputed Altered Expression [28]
Breast carcinoma DIS2UE88 Disputed Altered Expression [28]
Primary ciliary dyskinesia DISOBC7V Disputed Autosomal recessive [24]
Alzheimer disease DISF8S70 Limited Biomarker [4]
Congestive heart failure DIS32MEA Limited Genetic Variation [29]
Corpus callosum, agenesis of DISO9P40 Limited Biomarker [30]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [31]
Neoplasm DISZKGEW Limited Genetic Variation [5]
Neuroblastoma DISVZBI4 Limited Altered Expression [32]
Renal fibrosis DISMHI3I Limited Biomarker [33]
Rheumatoid arthritis DISTSB4J Limited Biomarker [34]
Temporal lobe epilepsy DISNOPXX Limited Biomarker [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cocaine DMSOX7I Approved Dynein axonemal heavy chain 8 (DNAH8) affects the response to substance of Cocaine. [9]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Dynein axonemal heavy chain 8 (DNAH8). [36]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Dynein axonemal heavy chain 8 (DNAH8). [37]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Dynein axonemal heavy chain 8 (DNAH8). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Dynein axonemal heavy chain 8 (DNAH8). [39]
------------------------------------------------------------------------------------

References

1 A quarter of patients with type 1 diabetes have co-existing non-islet autoimmunity: the findings of a UK population-based family study.Clin Exp Immunol. 2018 Jun;192(3):251-258. doi: 10.1111/cei.13115. Epub 2018 Mar 24.
2 Targeted molecular ablation of cancer stem cells for curing gastrointestinal cancers.Expert Rev Gastroenterol Hepatol. 2017 Nov;11(11):1059-1070. doi: 10.1080/17474124.2017.1356224. Epub 2017 Jul 27.
3 pNaKtide Attenuates Steatohepatitis and Atherosclerosis by Blocking Na/K-ATPase/ROS Amplification in C57Bl6 and ApoE Knockout Mice Fed a Western Diet.Sci Rep. 2017 Mar 15;7(1):193. doi: 10.1038/s41598-017-00306-5.
4 A Role for SERCA Pumps in the Neurobiology of Neuropsychiatric and Neurodegenerative Disorders.Adv Exp Med Biol. 2020;1131:131-161. doi: 10.1007/978-3-030-12457-1_6.
5 Hematopoietic stem cell specific V-ATPase controls breast cancer progression and metastasis via cytotoxic T cells.Oncotarget. 2018 Sep 4;9(69):33215-33231. doi: 10.18632/oncotarget.26061. eCollection 2018 Sep 4.
6 Targeting sarcoplasmic reticulum calcium ATPase by gene therapy.Hum Gene Ther. 2013 Nov;24(11):937-47. doi: 10.1089/hum.2013.2512.
7 Targeting protein-protein interactions for therapeutic discovery via FRET-based high-throughput screening in living cells.Sci Rep. 2018 Aug 22;8(1):12560. doi: 10.1038/s41598-018-29685-z.
8 Intramyocardial injection of SERCA2a-expressing lentivirus improves myocardial function in doxorubicin-induced heart failure.J Gene Med. 2016 Jul;18(7):124-33. doi: 10.1002/jgm.2885.
9 Substance dependence low-density whole genome association study in two distinct American populations. Hum Genet. 2008 Jun;123(5):495-506. doi: 10.1007/s00439-008-0501-0. Epub 2008 Apr 26.
10 Cytomegalovirus infection increases the expression and activity of ecto-ATPase (CD39) and ecto-5'nucleotidase (CD73) on endothelial cells.FEBS Lett. 2001 Feb 23;491(1-2):21-5. doi: 10.1016/s0014-5793(01)02085-3.
11 Association of ATP6V1B2 rs1106634 with lifetime risk of depression and hippocampal neurocognitive deficits: possible novel mechanisms in the etiopathology of depression.Transl Psychiatry. 2016 Nov 8;6(11):e945. doi: 10.1038/tp.2016.221.
12 Left ventricular phase entropy: Novel prognostic predictor in patients with dilated cardiomyopathy and narrow QRS.J Nucl Cardiol. 2018 Oct;25(5):1677-1687. doi: 10.1007/s12350-017-0807-1. Epub 2017 Feb 7.
13 Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
14 Reducing sarcolipin expression mitigates Duchenne muscular dystrophy and associated cardiomyopathy in mice.Nat Commun. 2017 Oct 20;8(1):1068. doi: 10.1038/s41467-017-01146-7.
15 De novo mutations of the ATP6V1A gene cause developmental encephalopathy with epilepsy. Brain. 2018 Jun 1;141(6):1703-1718. doi: 10.1093/brain/awy092.
16 Selective inhibition of tumor cell associated Vacuolar-ATPase 'a2' isoform overcomes cisplatin resistance in ovarian cancer cells.Mol Oncol. 2016 Jun;10(6):789-805. doi: 10.1016/j.molonc.2016.01.003. Epub 2016 Jan 29.
17 Ecto-ATP diphosphohydrolase/CD39 is overexpressed in differentiated human melanomas.FEBS Lett. 1998 Jul 3;430(3):227-30. doi: 10.1016/s0014-5793(98)00603-6.
18 A conserved inter-domain communication mechanism regulates the ATPase activity of the AAA-protein Drg1.Sci Rep. 2017 Mar 17;7:44751. doi: 10.1038/srep44751.
19 Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
20 Schekwanglupaside C, a new lupane saponin from Schefflera kwangsiensis, is a potent activator of sarcoplasmic reticulum Ca(2+)-ATPase.Fitoterapia. 2019 Sep;137:104150. doi: 10.1016/j.fitote.2019.04.005. Epub 2019 Apr 14.
21 Selective ATP hydrolysis inhibition in F1Fo ATP synthase enhances radiosensitivity in non-small-cell lung cancer cells (A549).Oncotarget. 2017 Jun 27;8(32):53602-53612. doi: 10.18632/oncotarget.18657. eCollection 2017 Aug 8.
22 Prolonged Exposure of Primary Human Muscle Cells to Plasma Fatty Acids Associated with Obese Phenotype Induces Persistent Suppression of Muscle Mitochondrial ATP Synthase Subunit.PLoS One. 2016 Aug 17;11(8):e0160057. doi: 10.1371/journal.pone.0160057. eCollection 2016.
23 The profibrotic effect of downregulated Na,KATPase 1 subunit in alveolar epithelial cells during lung fibrosis.Int J Mol Med. 2019 Jul;44(1):273-280. doi: 10.3892/ijmm.2019.4201. Epub 2019 May 16.
24 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
25 Therapeutic efficacy of artesunate in the treatment of uncomplicated Plasmodium falciparum malaria and anti-malarial, drug-resistance marker polymorphisms in populations near the China-Myanmar border.Malar J. 2012 Aug 16;11:278. doi: 10.1186/1475-2875-11-278.
26 Bi-allelic DNAH8 Variants Lead to Multiple Morphological Abnormalities of the Sperm Flagella and Primary Male Infertility. Am J Hum Genet. 2020 Aug 6;107(2):330-341. doi: 10.1016/j.ajhg.2020.06.004. Epub 2020 Jul 2.
27 Plasmalemmal vacuolar H+-ATPases in angiogenesis, diabetes and cancer.J Bioenerg Biomembr. 2007 Dec;39(5-6):427-33. doi: 10.1007/s10863-007-9108-8.
28 Rational design for heterologous production of aurovertin-type compounds in Aspergillus nidulans.Appl Microbiol Biotechnol. 2018 Jan;102(1):297-304. doi: 10.1007/s00253-017-8606-9. Epub 2017 Nov 2.
29 Rationale and design of the phase 2b clinical trials to study the effects of the partial adenosine A1-receptor agonist neladenoson bialanate in patients with chronic heart failure with reduced (PANTHEON) and preserved (PANACHE) ejection fraction.Eur J Heart Fail. 2018 Nov;20(11):1601-1610. doi: 10.1002/ejhf.1295. Epub 2018 Sep 17.
30 Advanced adenoid cystic carcinoma (ACC) is featured by SWI/SNF chromatin remodeling complex aberrations.J Cancer Res Clin Oncol. 2019 Jan;145(1):201-211. doi: 10.1007/s00432-018-2783-5. Epub 2018 Oct 31.
31 Identification of survival-related predictors in hepatocellular carcinoma through integrated genomic, transcriptomic, and proteomic analyses.Biomed Pharmacother. 2019 Jun;114:108856. doi: 10.1016/j.biopha.2019.108856. Epub 2019 Apr 10.
32 Upregulation of the Sarco-Endoplasmic Reticulum Calcium ATPase 1 Truncated Isoform Plays a Pathogenic Role in Alzheimer's Disease.Cells. 2019 Nov 28;8(12):1539. doi: 10.3390/cells8121539.
33 pNaKtide ameliorates renal interstitial fibrosis through inhibition of sodium-potassium adenosine triphosphatase-mediated signaling pathways in unilateral ureteral obstruction mice.Nephrol Dial Transplant. 2019 Feb 1;34(2):242-252. doi: 10.1093/ndt/gfy107.
34 AAA-ATPase p97 suppresses apoptotic and autophagy-associated cell death in rheumatoid arthritis synovial fibroblasts.Oncotarget. 2016 Sep 27;7(39):64221-64232. doi: 10.18632/oncotarget.11890.
35 Lack of association between temporal lobe epilepsy and a novel polymorphism in the alpha 2 subunit gene (ATP1A2) of the sodium potassium transporting ATPase.Am J Med Genet. 2000 Feb 7;96(1):79-83.
36 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
38 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
39 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
40 Substance dependence low-density whole genome association study in two distinct American populations. Hum Genet. 2008 Jun;123(5):495-506. doi: 10.1007/s00439-008-0501-0. Epub 2008 Apr 26.