Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJU04B1)

• DOT Name: Actin, alpha cardiac muscle 1 (ACTC1)
• Synonyms: EC 3.6.4.-; Alpha-cardiac actin
• Gene Name: ACTC1
• Related Disease:
  Hypertrophic cardiomyopathy
  Hypertrophic cardiomyopathy 11
  Atrial septal defect 5
  Autism spectrum disorder
  Breast cancer
  Breast carcinoma
  Cardiac failure
  Cardiomyopathy, familial restrictive, 1
  Congestive heart failure
  Dilated cardiomyopathy 1A
  Dilated cardiomyopathy 1R
  Familial dilated cardiomyopathy
  Familial hypertrophic cardiomyopathy
  Friedreich ataxia 1
  Gastric cancer
  Gastric neoplasm
  Glioblastoma multiforme
  Glioma
  Heart septal defect
  Hereditary diffuse gastric adenocarcinoma
  Hypercholesterolemia, familial, 1
  Left ventricular noncompaction
  Mitochondrial disease
  Myofibrillar myopathy
  Myopathy
  Nemaline myopathy
  Prostate cancer
  Prostate carcinoma
  Refractive error
  Schizophrenia
  Ventricular septal defect
  Dilated cardiomyopathy
  Tetralogy of fallot
  Obsolete familial isolated dilated cardiomyopathy
  High blood pressure
  Adult glioblastoma
  Atrial septal defect
  Cardiomyopathy
  Congenital heart disease
  Patent ductus arteriosus
  Precancerous condition
  Arrhythmogenic right ventricular cardiomyopathy
• UniProt ID: ACTC_HUMAN
• PDB ID: 8GSU; 8GSW; 8GT1; 8GT2; 8GT3; 8GT4; 8GT5
• EC Number: 3.6.4.-
• Pfam ID: PF00022
• Sequence:
  MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
  DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
  SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
  LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
  KQEYDEAGPSIVHRKCF
• Function: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
• KEGG Pathway:
  Cardiac muscle contraction (hsa04260)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Motor proteins (hsa04814)
  Cytoskeleton in muscle cells (hsa04820)
  Hypertrophic cardiomyopathy (hsa05410)
  Dilated cardiomyopathy (hsa05414)
• Reactome Pathway:
  RHOA GTPase cycle (R-HSA-8980692)
  RHOB GTPase cycle (R-HSA-9013026)
  Striated Muscle Contraction (R-HSA-390522)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hypertrophic cardiomyopathy	DISQG2AI	Definitive	Autosomal dominant	[1]
Hypertrophic cardiomyopathy 11	DIS4PP6I	Definitive	Autosomal dominant	[2]
Atrial septal defect 5	DISAR865	Strong	Autosomal dominant	[3]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Cardiac failure	DISDC067	Strong	Genetic Variation	[6]
Cardiomyopathy, familial restrictive, 1	DIS4AJ17	Strong	Genetic Variation	[7]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[6]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[8]
Dilated cardiomyopathy 1R	DISOX2XM	Strong	Autosomal dominant	[9]
Familial dilated cardiomyopathy	DISBHDU9	Strong	Genetic Variation	[2]
Familial hypertrophic cardiomyopathy	DISQ89HN	Strong	Genetic Variation	[10]
Friedreich ataxia 1	DIS285GE	Strong	Biomarker	[11]
Gastric cancer	DISXGOUK	Strong	Biomarker	[12]
Gastric neoplasm	DISOKN4Y	Strong	Biomarker	[12]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[13]
Glioma	DIS5RPEH	Strong	Altered Expression	[14]
Heart septal defect	DISQ5C5J	Strong	Genetic Variation	[15]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[12]
Hypercholesterolemia, familial, 1	DISU411W	Strong	Genetic Variation	[16]
Left ventricular noncompaction	DISJ4QEG	Strong	Genetic Variation	[17]
Mitochondrial disease	DISKAHA3	Strong	Genetic Variation	[18]
Myofibrillar myopathy	DISF24LW	Strong	Genetic Variation	[19]
Myopathy	DISOWG27	Strong	Altered Expression	[20]
Nemaline myopathy	DIS5IYLY	Strong	Genetic Variation	[21]
Prostate cancer	DISF190Y	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[20]
Refractive error	DISWNEQ1	Strong	Biomarker	[22]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[23]
Ventricular septal defect	DISICO41	Strong	Biomarker	[24]
Dilated cardiomyopathy	DISX608J	Moderate	Autosomal dominant	[1]
Tetralogy of fallot	DISMHFNW	moderate	Biomarker	[25]
Obsolete familial isolated dilated cardiomyopathy	DIS4FXO4	Supportive	Autosomal dominant	[26]
High blood pressure	DISY2OHH	Disputed	Biomarker	[27]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[13]
Atrial septal defect	DISJT76B	Limited	Genetic Variation	[28]
Cardiomyopathy	DISUPZRG	Limited	Genetic Variation	[29]
Congenital heart disease	DISQBA23	Limited	Altered Expression	[30]
Patent ductus arteriosus	DIS9P8YS	Limited	Genetic Variation	[31]
Precancerous condition	DISV06FL	Limited	Biomarker	[32]
Arrhythmogenic right ventricular cardiomyopathy	DIS3V2BE	No Known	Autosomal dominant	[1]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[36]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[37]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[38]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[39]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[40]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[41]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[42]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[43]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[44]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[45]
Estriol	DMOEM2I	Approved	Estriol affects the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[37]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[46]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[50]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[51]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[52]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Actin, alpha cardiac muscle 1 (ACTC1).	[53]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Actin, alpha cardiac muscle 1 (ACTC1).	[48]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Inherited and de novo mutations in the cardiac actin gene cause hypertrophic cardiomyopathy. J Mol Cell Cardiol. 2000 Sep;32(9):1687-94. doi: 10.1006/jmcc.2000.1204.
• [3] Alpha-cardiac actin mutations produce atrial septal defects. Hum Mol Genet. 2008 Jan 15;17(2):256-65. doi: 10.1093/hmg/ddm302. Epub 2007 Oct 18.
• [4] Exome sequencing identifies a novel variant in ACTC1 associated with familial atrial septal defect.Can J Cardiol. 2014 Feb;30(2):181-7. doi: 10.1016/j.cjca.2013.12.003. Epub 2013 Dec 6.
• [5] Identification of genes and pathways associated with MDR in MCF-7/MDR breast cancer cells by RNA-seq analysis.Mol Med Rep. 2018 May;17(5):6211-6226. doi: 10.3892/mmr.2018.8704. Epub 2018 Mar 7.
• [6] Molecular mechanism of the E99K mutation in cardiac actin (ACTC Gene) that causes apical hypertrophy in man and mouse.J Biol Chem. 2011 Aug 5;286(31):27582-93. doi: 10.1074/jbc.M111.252320. Epub 2011 May 26.
• [7] Idiopathic restrictive cardiomyopathy in children is caused by mutations in cardiac sarcomere protein genes. Heart. 2008 Nov;94(11):1478-84. doi: 10.1136/hrt.2007.134684. Epub 2008 May 8.
• [8] A cardiac -actin (ACTC1) p. Gly247Asp mutation inhibits SRF-signaling invitro in neonatal rat cardiomyocytes.Biochem Biophys Res Commun. 2019 Oct 20;518(3):500-505. doi: 10.1016/j.bbrc.2019.08.081. Epub 2019 Aug 18.
• [9] Human actin mutations associated with hypertrophic and dilated cardiomyopathies demonstrate distinct thin filament regulatory properties in vitro. J Mol Cell Cardiol. 2010 Feb;48(2):286-92. doi: 10.1016/j.yjmcc.2009.09.014. Epub 2009 Sep 30.
• [10] Novel -Actin Gene Mutation p.(Ala21Val) Causing Familial Hypertrophic Cardiomyopathy, Myocardial Noncompaction, and Transmural Crypts. Clinical-Pathologic Correlation.J Am Heart Assoc. 2018 Feb 10;7(4):e008068. doi: 10.1161/JAHA.117.008068.
• [11] Quantitative Proteomic and Network Analysis of Differentially Expressed Proteins in PBMC of Friedreich's Ataxia (FRDA) Patients.Front Neurosci. 2019 Oct 14;13:1054. doi: 10.3389/fnins.2019.01054. eCollection 2019.
• [12] Two-dimensional differential in-gel electrophoresis for identification of gastric cancer-specific protein markers.Oncol Rep. 2009 Jun;21(6):1429-37. doi: 10.3892/or_00000371.
• [13] Actin, alpha, cardiac muscle 1 (ACTC1) knockdown inhibits the migration of glioblastoma cells in vitro.J Neurol Sci. 2018 Sep 15;392:117-121. doi: 10.1016/j.jns.2018.07.013. Epub 2018 Jul 17.
• [14] ACTC1 as an invasion and prognosis marker in glioma.J Neurosurg. 2017 Feb;126(2):467-475. doi: 10.3171/2016.1.JNS152075. Epub 2016 Apr 15.
• [15] Mutation in the alpha-cardiac actin gene associated with apical hypertrophic cardiomyopathy, left ventricular non-compaction, and septal defects.Eur Heart J. 2007 Aug;28(16):1953-61. doi: 10.1093/eurheartj/ehm239. Epub 2007 Jul 4.
• [16] Alpha-cardiac actin is a novel disease gene in familial hypertrophic cardiomyopathy. J Clin Invest. 1999 May 15;103(10):R39-43. doi: 10.1172/JCI6460.
• [17] Familial left ventricular noncompaction associated with a novel mutation in the alpha-cardiac actin gene.Rev Esp Cardiol (Engl Ed). 2014 Oct;67(10):857-9. doi: 10.1016/j.rec.2014.05.015. Epub 2014 Sep 5.
• [18] Cardiogenetics, neurogenetics, and pathogenetics of left ventricular hypertrabeculation/noncompaction.Pediatr Cardiol. 2009 Jul;30(5):659-81. doi: 10.1007/s00246-008-9359-0. Epub 2009 Jan 29.
• [19] Proteome and transcriptome profiling of equine myofibrillar myopathy identifies diminished peroxiredoxin 6 and altered cysteine metabolic pathways.Physiol Genomics. 2018 Dec 1;50(12):1036-1050. doi: 10.1152/physiolgenomics.00044.2018. Epub 2018 Oct 5.
• [20] Actin alpha cardiac muscle 1 gene expression is upregulated in the skeletal muscle of men undergoing androgen deprivation therapy for prostate cancer.J Steroid Biochem Mol Biol. 2017 Nov;174:56-64. doi: 10.1016/j.jsbmb.2017.07.029. Epub 2017 Jul 27.
• [21] Functional effects of nemaline myopathy mutations on human skeletal alpha-actin.J Biol Chem. 2008 Jul 11;283(28):19379-88. doi: 10.1074/jbc.M801963200. Epub 2008 May 12.
• [22] A genome-wide association study identifies a susceptibility locus for refractive errors and myopia at 15q14.Nat Genet. 2010 Oct;42(10):897-901. doi: 10.1038/ng.663. Epub 2010 Sep 12.
• [23] No evidence for linkage between schizophrenia and markers at chromosome 15q13-14.Am J Med Genet. 1999 Apr 16;88(2):109-12. doi: 10.1002/(sici)1096-8628(19990416)88:2<109::aid-ajmg1>3.0.co;2-3.
• [24] The NFKB1 -94 ATTG insertion/deletion polymorphism (rs28362491) contributes to the susceptibility of congenital heart disease in a Chinese population.Gene. 2013 Mar 10;516(2):307-10. doi: 10.1016/j.gene.2012.12.078. Epub 2013 Jan 5.
• [25] Prenatal diagnosis and molecular cytogenetic characterization of a de novo 4.858-Mb microdeletion in 15q14 associated with ACTC1 and MEIS2 haploinsufficiency and tetralogy of Fallot.Taiwan J Obstet Gynecol. 2016 Apr;55(2):270-4. doi: 10.1016/j.tjog.2016.02.013.
• [26] Actin mutations in dilated cardiomyopathy, a heritable form of heart failure. Science. 1998 May 1;280(5364):750-2. doi: 10.1126/science.280.5364.750.
• [27] Nifedipine represses ion channels, transporters and Ca(2+)-binding proteins in hearts of spontaneously hypertensive rats.Toxicol Appl Pharmacol. 2006 Jun 15;213(3):224-34. doi: 10.1016/j.taap.2005.10.012. Epub 2005 Dec 15.
• [28] Cardiac -Actin (ACTC1) Gene Mutation Causes Atrial-Septal Defects Associated With Late-Onset Dilated Cardiomyopathy.Circ Genom Precis Med. 2019 Aug;12(8):e002491. doi: 10.1161/CIRCGEN.119.002491. Epub 2019 Aug 20.
• [29] A Novel Alpha Cardiac Actin (ACTC1) Mutation Mapping to a Domain in Close Contact with Myosin Heavy Chain Leads to a Variety of Congenital Heart Defects, Arrhythmia and Possibly Midline Defects.PLoS One. 2015 Jun 10;10(6):e0127903. doi: 10.1371/journal.pone.0127903. eCollection 2015.
• [30] Reduced ACTC1 expression might play a role in the onset of congenital heart disease by inducing cardiomyocyte apoptosis.Circ J. 2010 Nov;74(11):2410-8. doi: 10.1253/circj.cj-10-0234. Epub 2010 Oct 15.
• [31] Congenital heart defects are rarely caused by mutations in cardiac and smooth muscle actin genes.Biomed Res Int. 2015;2015:127807. doi: 10.1155/2015/127807. Epub 2015 Mar 10.
• [32] Hepatocellular carcinoma-associated protein markers investigated by MALDI-TOF MS.Mol Med Rep. 2010 Jul-Aug;3(4):589-96. doi: 10.3892/mmr_00000302.
• [33] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [34] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] The effect of estrogen compounds on human embryoid bodies. Reprod Sci. 2013 Jun;20(6):661-9. doi: 10.1177/1933719112462630. Epub 2012 Nov 26.
• [38] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [39] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [40] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [41] Neuronal and cardiac toxicity of pharmacological compounds identified through transcriptomic analysis of human pluripotent stem cell-derived embryoid bodies. Toxicol Appl Pharmacol. 2021 Dec 15;433:115792. doi: 10.1016/j.taap.2021.115792. Epub 2021 Nov 3.
• [42] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [43] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [44] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [45] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [51] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [52] Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
• [53] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.