Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL68EL4)

• DOT Name: Lamina-associated polypeptide 2, isoform alpha (TMPO)
• Synonyms: Thymopoietin isoform alpha; TP alpha; Thymopoietin-related peptide isoform alpha; TPRP isoform alpha
• Gene Name: TMPO
• Related Disease:
  Gastric cancer
  Matthew-Wood syndrome
  Pancreatic ductal carcinoma
  Prostatitis
  Stomach cancer
  Advanced cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of esophagus
  Castration-resistant prostate carcinoma
  Dilated cardiomyopathy 1A
  Esophageal cancer
  Estrogen-receptor positive breast cancer
  Familial dilated cardiomyopathy
  Herpes simplex infection
  Lung neoplasm
  Myocardial ischemia
  Neoplasm
  Neoplasm of esophagus
  Non-alcoholic fatty liver disease
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Adult glioblastoma
  Breast cancer
  Fetal growth restriction
  Glioblastoma multiforme
  Obsolete familial isolated dilated cardiomyopathy
  Cardiomyopathy
  Large cell carcinoma
  Dilated cardiomyopathy
  Hypertrophic cardiomyopathy
• UniProt ID: LAP2A_HUMAN
• PDB ID: 1GJJ; 1H9E; 1H9F; 8FN7; 8FND; 8FNG; 8FNH; 8FNJ; 8FNL; 8FNM; 8FNN; 8FNO; 8FNP; 8FNQ
• Pfam ID: PF11560 ; PF03020 ; PF08198
• Sequence:
  MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSK
  GPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDL
  LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDS
  DRYSDNEEGKKKEHKKVKSTRDIVPFSELGTTPSGGGFFQGISFPEISTRPPLGSTELQA
  AKKVHTSKGDLPREPLVATNLPGRGQLQKLASERNLFISCKSSHDRCLEKSSSSSSQPEH
  SAMLVSTAASPSLIKETTTGYYKDIVENICGREKSGIQPLCPERSHISDQSPLSSKRKAL
  EESESSQLISPPLAQAIRDYVNSLLVQGGVGSLPGTSNSMPPLDVENIQKRIDQSKFQET
  EFLSPPRKVPRLSEKSVEERDSGSFVAFQNIPGSELMSSFAKTVVSHSLTTLGLEVAKQS
  QHDKIDASELSFPFHESILKVIEEEWQQVDRQLPSLACKYPVSSREATQILSVPKVDDEI
  LGFISEATPLGGIQAASTESCNQQLDLALCRAYEAAASALQIATHTAFVAKAMQADISQA
  AQILSSDPSRTHQALGILSKTYDAASYICEAAFDEVKMAAHTMGNATVGRRYLWLKDCKI
  NLASKNKLASTPFKGGTLFGGEVCKVIKKRGNKH
• Function: May be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. Plays an important role, together with LMNA, in the nuclear anchorage of RB1.; TP and TP5 may play a role in T-cell development and function. TP5 is an immunomodulating pentapeptide.
• Tissue Specificity: Expressed in many tissues. Most abundant in adult thymus and fetal liver.

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Definitive	Altered Expression	[1]
Matthew-Wood syndrome	DISA7HR7	Definitive	Altered Expression	[2]
Pancreatic ductal carcinoma	DIS26F9Q	Definitive	Altered Expression	[2]
Prostatitis	DISL8OGN	Definitive	Altered Expression	[3]
Stomach cancer	DISKIJSX	Definitive	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Carcinoma	DISH9F1N	Strong	Biomarker	[5]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[6]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Altered Expression	[7]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[8]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[6]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Biomarker	[9]
Familial dilated cardiomyopathy	DISBHDU9	Strong	Genetic Variation	[10]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[11]
Lung neoplasm	DISVARNB	Strong	Biomarker	[12]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Altered Expression	[14]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[6]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[15]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[16]
Prostate cancer	DISF190Y	Strong	Biomarker	[7]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[7]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[17]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[18]
Breast cancer	DIS7DPX1	moderate	Biomarker	[5]
Fetal growth restriction	DIS5WEJ5	moderate	Altered Expression	[19]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[18]
Obsolete familial isolated dilated cardiomyopathy	DIS4FXO4	Supportive	Autosomal dominant	[10]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[20]
Large cell carcinoma	DISYMCOF	Limited	Genetic Variation	[21]
Dilated cardiomyopathy	DISX608J	Refuted	Autosomal dominant	[22]
Hypertrophic cardiomyopathy	DISQG2AI	No Known	Autosomal dominant	[23]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	Lamina-associated polypeptide 2, isoform alpha (TMPO) affects the response to substance of Vinblastine.	[59]

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[24]
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[32]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the phosphorylation of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[47]
G1	DMTV42K	Phase 1/2	G1 decreases the phosphorylation of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[50]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[53]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[32]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[32]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[25]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[26]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[29]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[30]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[31]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[33]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[34]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[35]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[37]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[36]
Menadione	DMSJDTY	Approved	Menadione decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[35]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[38]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[39]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[40]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[41]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[42]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[43]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[44]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[44]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[45]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[46]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[26]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[30]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[49]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[25]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[51]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[52]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[54]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[55]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[39]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[56]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[57]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[58]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Lamina-associated polypeptide 2, isoform alpha (TMPO).	[48]

References

• [1] Clinicopathologic and Prognostic Significance of Thymopoietin- Overexpression in Gastric Cancer.J Cancer. 2019 Aug 28;10(21):5099-5107. doi: 10.7150/jca.30738. eCollection 2019.
• [2] Downregulation of thymopoietin by miR-139-5p suppresses cell proliferation and induces cell cycle arrest/apoptosis in pancreatic ductal adenocarcinoma.Oncol Lett. 2019 Oct;18(4):3443-3452. doi: 10.3892/ol.2019.10679. Epub 2019 Jul 29.
• [3] Differential expression of the TP and TP isoforms of the human T Prostanoid receptor during chronic inflammation of the prostate: Role for FOXP1 in the transcriptional regulation of TP during monocyte-macrophage differentiation.Exp Mol Pathol. 2019 Oct;110:104277. doi: 10.1016/j.yexmp.2019.104277. Epub 2019 Jul 2.
• [4] LAP2 is widely overexpressed in diverse digestive tract cancers and regulates motility of cancer cells.PLoS One. 2012;7(6):e39482. doi: 10.1371/journal.pone.0039482. Epub 2012 Jun 20.
• [5] Thymopoietin Beta and Gamma Isoforms as a Potential Diagnostic Molecular Marker for Breast Cancer: Preliminary Data.Pathol Oncol Res. 2015 Sep;21(4):1045-50. doi: 10.1007/s12253-015-9907-x. Epub 2015 Apr 4.
• [6] Transcriptional regulation of miR-146b by C/EBP LAP2 in esophageal cancer cells.Biochem Biophys Res Commun. 2014 Mar 28;446(1):267-71. doi: 10.1016/j.bbrc.2014.02.096. Epub 2014 Feb 28.
• [7] Regulation of protein kinase C-related kinase (PRK) signalling by the TP and TP isoforms of the human thromboxane A(2) receptor: Implications for thromboxane- and androgen- dependent neoplastic and epigenetic responses in prostate cancer.Biochim Biophys Acta Mol Basis Dis. 2017 Apr;1863(4):838-856. doi: 10.1016/j.bbadis.2017.01.011. Epub 2017 Jan 18.
• [8] Genetic and ultrastructural studies in dilated cardiomyopathy patients: a large deletion in the lamin A/C gene is associated with cardiomyocyte nuclear envelope disruption.Basic Res Cardiol. 2010 May;105(3):365-77. doi: 10.1007/s00395-010-0085-4. Epub 2010 Feb 3.
• [9] ESR1-Stabilizing Long Noncoding RNA TMPO-AS1 Promotes Hormone-Refractory Breast Cancer Progression.Mol Cell Biol. 2019 Nov 12;39(23):e00261-19. doi: 10.1128/MCB.00261-19. Print 2019 Dec 1.
• [10] Thymopoietin (lamina-associated polypeptide 2) gene mutation associated with dilated cardiomyopathy. Hum Mutat. 2005 Dec;26(6):566-74. doi: 10.1002/humu.20250.
• [11] Long-term neuroprotection achieved with latency-associated promoter-driven herpes simplex virus gene transfer to the peripheral nervous system.Mol Ther. 2005 Aug;12(2):307-13. doi: 10.1016/j.ymthe.2005.04.009.
• [12] Thromboxane A2 receptor promotes tumor growth through an autoregulatory feedback pathway.J Mol Cell Biol. 2013 Dec;5(6):380-90. doi: 10.1093/jmcb/mjt038. Epub 2013 Oct 9.
• [13] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [14] Expression of the TP and TP isoforms of the thromboxane prostanoid receptor (TP) in prostate cancer: clinical significance and diagnostic potential.Oncotarget. 2016 Nov 8;7(45):73171-73187. doi: 10.18632/oncotarget.12256.
• [15] Nuclear lamina genetic variants, including a truncated LAP2, in twins and siblings with nonalcoholic fatty liver disease.Hepatology. 2018 May;67(5):1710-1725. doi: 10.1002/hep.29522. Epub 2018 Mar 24.
• [16] Prognostic significance and biological function of Lamina-associated polypeptide 2 in non-small-cell lung cancer.Onco Targets Ther. 2019 May 16;12:3817-3827. doi: 10.2147/OTT.S179870. eCollection 2019.
• [17] From transcriptome to proteome: differentially expressed proteins identified in synovial tissue of patients suffering from rheumatoid arthritis and osteoarthritis by an initial screen with a panel of 791 antibodies.Proteomics. 2003 Jun;3(6):991-1002. doi: 10.1002/pmic.200300412.
• [18] Depletion of thymopoietin inhibits proliferation and induces cell cycle arrest/apoptosis in glioblastoma cells.World J Surg Oncol. 2016 Oct 19;14(1):267. doi: 10.1186/s12957-016-1018-y.
• [19] Role for the thromboxane A2 receptor -isoform in the pathogenesis of intrauterine growth restriction.Sci Rep. 2016 Jul 1;6:28811. doi: 10.1038/srep28811.
• [20] Analysis of RNA-Seq datasets reveals enrichment of tissue-specific splice variants for nuclear envelope proteins.Nucleus. 2018;9(1):410-430. doi: 10.1080/19491034.2018.1469351.
• [21] Constitutional abnormality of nuclear membrane proteins in small cell lung carcinoma.Virchows Arch. 2019 Oct;475(4):407-414. doi: 10.1007/s00428-019-02597-7. Epub 2019 Jun 15.
• [22] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [23] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [24] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [25] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [26] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [27] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [30] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [31] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [32] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [33] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [34] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [35] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [36] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [37] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [38] Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
• [39] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [40] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [41] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [42] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [43] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [44] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [45] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [46] Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
• [47] Phosphoproteomics reveals resveratrol-dependent inhibition of Akt/mTORC1/S6K1 signaling. J Proteome Res. 2014 Dec 5;13(12):5734-42. doi: 10.1021/pr500714a. Epub 2014 Oct 29.
• [48] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [49] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [50] The G Protein-Coupled Estrogen Receptor Agonist G-1 Inhibits Nuclear Estrogen Receptor Activity and Stimulates Novel Phosphoproteomic Signatures. Toxicol Sci. 2016 Jun;151(2):434-46. doi: 10.1093/toxsci/kfw057. Epub 2016 Mar 29.
• [51] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [52] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [53] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [54] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [55] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [56] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [57] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [58] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [59] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.