Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL81AVZ)

• DOT Name: Tapasin (TAPBP)
• Synonyms: TPN; TPSN; NGS-17; TAP-associated protein; TAP-binding protein
• Gene Name: TAPBP
• Related Disease:
  Glioblastoma multiforme
  T-cell acute lymphoblastic leukaemia
  Acute graft versus host disease
  Adult respiratory distress syndrome
  Ankylosing spondylitis
  Carcinoma
  Cholestasis
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Congenital alveolar dysplasia
  Craniosynostosis
  Cryohydrocytosis
  Gastric cancer
  Hepatitis C virus infection
  Immunodeficiency
  Lung carcinoma
  Matthew-Wood syndrome
  Metastatic malignant neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Renal cell carcinoma
  Rheumatoid arthritis
  Schizophrenia
  Small-cell lung cancer
  Type-1/2 diabetes
  Advanced cancer
  MHC class I deficiency
  Neuroblastoma
  Cervical cancer
  Cervical carcinoma
  Severe combined immunodeficiency
  Acute diarrhea
  Asthma
  Brooke-Spiegler syndrome
  Diarrhea
  Ileus
  Secretory diarrhea
  Type-1 diabetes
  Vibrio cholerae infection
• UniProt ID: TPSN_HUMAN
• PDB ID: 3F8U; 6ENY; 7QNG; 7QPD; 7TUE; 7TUF; 7TUG
• Pfam ID: PF07654
• Sequence:
  MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDL
  DPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD
  GAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDL
  SFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAA
  WDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPAT
  LARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSV
  SLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA
  FLLLGLFKALGWAAVYLSTCKDSKKKAE
• Function: Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).
• Tissue Specificity: Neutrophils, mostly in fully differentiated cells.
• KEGG Pathway:
  Antigen processing and presentation (hsa04612)
  Human cytomegalovirus infection (hsa05163)
  Herpes simplex virus 1 infection (hsa05168)
  Epstein-Barr virus infection (hsa05169)
  Human immunodeficiency virus 1 infection (hsa05170)
• Reactome Pathway:
  Antigen Presentation (R-HSA-983170)
  ER-Phagosome pathway (R-HSA-1236974)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Definitive	Biomarker	[2]
Acute graft versus host disease	DIS8KLVM	Strong	Biomarker	[3]
Adult respiratory distress syndrome	DISIJV47	Strong	Genetic Variation	[4]
Ankylosing spondylitis	DISRC6IR	Strong	Biomarker	[5]
Carcinoma	DISH9F1N	Strong	Altered Expression	[6]
Cholestasis	DISDJJWE	Strong	Biomarker	[4]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[7]
Colon cancer	DISVC52G	Strong	Biomarker	[8]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[9]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[10]
Congenital alveolar dysplasia	DIS1IYUN	Strong	Genetic Variation	[4]
Craniosynostosis	DIS6J405	Strong	Biomarker	[11]
Cryohydrocytosis	DISMQHL3	Strong	Genetic Variation	[12]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[14]
Immunodeficiency	DIS093I0	Strong	Biomarker	[11]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[6]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[15]
Metastatic malignant neoplasm	DIS86UK6	Strong	Genetic Variation	[16]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[8]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[7]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[18]
Schizophrenia	DISSRV2N	Strong	Biomarker	[19]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[20]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[17]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[21]
MHC class I deficiency	DISSMWCT	Moderate	Autosomal recessive	[22]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[23]
Cervical cancer	DISFSHPF	Disputed	Biomarker	[24]
Cervical carcinoma	DIST4S00	Disputed	Biomarker	[24]
Severe combined immunodeficiency	DIS6MF4Q	Disputed	Biomarker	[25]
Acute diarrhea	DISVH6GQ	Limited	Biomarker	[26]
Asthma	DISW9QNS	Limited	Genetic Variation	[27]
Brooke-Spiegler syndrome	DIS36OT6	Limited	Biomarker	[28]
Diarrhea	DISWTJQL	Limited	Altered Expression	[26]
Ileus	DISH7JW9	Limited	Genetic Variation	[29]
Secretory diarrhea	DISBX8WG	Limited	Altered Expression	[26]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[30]
Vibrio cholerae infection	DISW7E3U	Limited	Altered Expression	[26]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Tapasin (TAPBP).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Tapasin (TAPBP).	[32]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Tapasin (TAPBP).	[33]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Tapasin (TAPBP).	[34]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Tapasin (TAPBP).	[36]
Selenium	DM25CGV	Approved	Selenium increases the expression of Tapasin (TAPBP).	[37]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Tapasin (TAPBP).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Tapasin (TAPBP).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Tapasin (TAPBP).	[42]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Tapasin (TAPBP).	[43]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Tapasin (TAPBP).	[44]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Tapasin (TAPBP).	[35]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Tapasin (TAPBP).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Tapasin (TAPBP).	[40]

References

• [1] Tapasin and human leukocyte antigen class I dysregulation correlates with survival in glioblastoma multiforme.Anticancer Agents Med Chem. 2014;14(8):1101-9. doi: 10.2174/1871520614666140825110402.
• [2] Neutropenic acute acalculous cholecystitis (AAC) in a 12-year-old boy with T-acute lymphoblastic leukemia successfully managed with conservative treatment.Pediatr Hematol Oncol. 2017 Feb;34(1):24-28. doi: 10.1080/08880018.2016.1265034. Epub 2017 Jan 13.
• [3] HLA, GVHD, and parenteral nutrition are risk factors for hepatic complications in pediatric HSCT.Pediatr Transplant. 2016 Feb;20(1):96-104. doi: 10.1111/petr.12623. Epub 2015 Oct 31.
• [4] Understanding the relationship between hospital volume and patient outcomes for infants with gastroschisis.J Pediatr Surg. 2017 Dec;52(12):1977-1980. doi: 10.1016/j.jpedsurg.2017.08.065. Epub 2017 Sep 5.
• [5] Computational characterization of residue couplings and micropolymorphism-induced changes in the dynamics of two differentially disease-associated human MHC class-I alleles.J Biomol Struct Dyn. 2018 Feb;36(3):724-740. doi: 10.1080/07391102.2017.1295884. Epub 2017 Mar 1.
• [6] Combining the antigen processing components TAP and Tapasin elicits enhanced tumor-free survival.Clin Cancer Res. 2008 Mar 1;14(5):1494-501. doi: 10.1158/1078-0432.CCR-07-1066.
• [7] Characterization of human lymphocyte antigen class I antigen-processing machinery defects in renal cell carcinoma lesions with special emphasis on transporter-associated with antigen-processing down-regulation.Clin Cancer Res. 2003 May;9(5):1721-7.
• [8] Loss of tapasin in human lung and colon cancer cells and escape from tumor-associated antigen-specific CTL recognition.Oncoimmunology. 2017 Jan 3;6(2):e1274476. doi: 10.1080/2162402X.2016.1274476. eCollection 2017.
• [9] Loss of tapasin correlates with diminished CD8(+) T-cell immunity and prognosis in colorectal cancer.J Transl Med. 2015 Aug 27;13:279. doi: 10.1186/s12967-015-0647-1.
• [10] Involvement of the chaperone tapasin in HLA-B44 allelic losses in colorectal tumors.Int J Cancer. 2005 Feb 10;113(4):611-8. doi: 10.1002/ijc.20526.
• [11] CD8A gene polymorphisms predict severity factors in chronic rhinosinusitis.Int Forum Allergy Rhinol. 2013 Aug;3(8):605-11. doi: 10.1002/alr.21174. Epub 2013 May 2.
• [12] The association of LMP7 and TAP2 gene polymorphisms with treatment response to interferon/ribavirin in patients with genotype 1 chronic hepatitis C.Int J Mol Med. 2017 Dec;40(6):1983-1990. doi: 10.3892/ijmm.2017.3180. Epub 2017 Oct 10.
• [13] Characterization of the immune escape phenotype of human gastric cancers with and without high-frequency microsatellite instability.J Pathol. 2007 Apr;211(5):516-523. doi: 10.1002/path.2142.
• [14] Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.PLoS One. 2015 Apr 13;10(4):e0123513. doi: 10.1371/journal.pone.0123513. eCollection 2015.
• [15] Personalized RNA Medicine for Pancreatic Cancer.Clin Cancer Res. 2018 Apr 1;24(7):1734-1747. doi: 10.1158/1078-0432.CCR-17-2733. Epub 2018 Jan 12.
• [16] MHC class I antigen processing pathway defects, ras mutations and disease stage in colorectal carcinoma.Int J Cancer. 2004 Mar 20;109(2):265-73. doi: 10.1002/ijc.11681.
• [17] Regular insulin added to total parenteral nutrition vs subcutaneous glargine in non-critically ill diabetic inpatients, a multicenter randomized clinical trial: INSUPAR trial.Clin Nutr. 2020 Feb;39(2):388-394. doi: 10.1016/j.clnu.2019.02.036. Epub 2019 Mar 20.
• [18] A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.Ann Rheum Dis. 2011 Feb;70(2):259-65. doi: 10.1136/ard.2009.126821. Epub 2010 Dec 14.
• [19] Transporter associated with antigen processing and the chaperone tapasin: are non-classical HLA genes keys to the pathogenesis of schizophrenia?.Med Hypotheses. 2009 May;72(5):535-8. doi: 10.1016/j.mehy.2008.12.036. Epub 2009 Feb 12.
• [20] Targeting tumour cells with defects in the MHC Class I antigen processing pathway with CD8+ T cells specific for hydrophobic TAP- and Tapasin-independent peptides: the requirement for directed access into the ER.Cancer Immunol Immunother. 2007 Aug;56(8):1143-52. doi: 10.1007/s00262-006-0263-2. Epub 2006 Dec 2.
• [21] The glutamine debate in surgery and critical care.Curr Opin Crit Care. 2019 Aug;25(4):322-328. doi: 10.1097/MCC.0000000000000633.
• [22] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [23] Lack of HLA-class I antigens in human neuroblastoma cells: analysis of its relationship to TAP and tapasin expression.Tissue Antigens. 2001 Feb;57(2):110-7. doi: 10.1034/j.1399-0039.2001.057002110.x.
• [24] Variation in HLA class I antigen-processing genes and susceptibility to human papillomavirus type 16-associated cervical cancer.J Infect Dis. 2008 Feb 1;197(3):371-81. doi: 10.1086/524300.
• [25] A subject with a novel type I bare lymphocyte syndrome has tapasin deficiency due to deletion of 4 exons by Alu-mediated recombination. Blood. 2002 Aug 15;100(4):1496-8. doi: 10.1182/blood-2001-12-0252.
• [26] Antidiarrheal activity of -terpineol in mice.Biomed Pharmacother. 2019 Feb;110:631-640. doi: 10.1016/j.biopha.2018.11.131. Epub 2018 Dec 9.
• [27] Association analysis of tapasin polymorphisms with aspirin-exacerbated respiratory disease in asthmatics.Pharmacogenet Genomics. 2013 Jul;23(7):341-8. doi: 10.1097/FPC.0b013e328361d4bb.
• [28] Ghrelin stimulates intestinal adaptation following massive small bowel resection in parenterally fed rats.Peptides. 2018 Aug;106:59-67. doi: 10.1016/j.peptides.2018.06.009. Epub 2018 Jun 30.
• [29] Redefining the implications of nasogastric tube placement following radical cystectomy in the alvimopan era.World J Urol. 2017 Apr;35(4):625-631. doi: 10.1007/s00345-016-1910-7. Epub 2016 Jul 30.
• [30] Sequence variation within the major histocompatibility complex subregion centromeric of HLA class II in type 1 diabetes.Tissue Antigens. 2007 Apr;69(4):348-53. doi: 10.1111/j.1399-0039.2007.00820.x.
• [31] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [32] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [33] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [34] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [35] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [36] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [37] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [38] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [39] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [42] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [43] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [44] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.