Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMSIEZY)

• DOT Name: Aryl hydrocarbon receptor nuclear translocator (ARNT)
• Synonyms: ARNT protein; Class E basic helix-loop-helix protein 2; bHLHe2; Dioxin receptor, nuclear translocator; Hypoxia-inducible factor 1-beta; HIF-1-beta; HIF1-beta
• Gene Name: ARNT
• Related Disease:
  Anaplastic large cell lymphoma
  B-cell lymphoma
  Breast neoplasm
  Colon cancer
  Colon carcinoma
  Colorectal adenoma
  Colorectal carcinoma
  Colorectal neoplasm
  Cutaneous melanoma
  Epithelial ovarian cancer
  Essential hypertension
  Fatty liver disease
  Gastrointestinal stromal tumour
  Hepatocellular carcinoma
  Leiomyoma
  Liver cirrhosis
  Melanoma
  Metastatic malignant neoplasm
  Non-alcoholic fatty liver disease
  Non-alcoholic steatohepatitis
  Non-insulin dependent diabetes
  Ovarian cancer
  Ovarian neoplasm
  Prostate neoplasm
  Schizophrenia
  Uterine fibroids
  Age-related macular degeneration
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Hypoglycemia
  Liver cancer
  Meningioma
  Plasma cell myeloma
  Small lymphocytic lymphoma
  Acute myelogenous leukaemia
  Advanced cancer
  Childhood acute lymphoblastic leukemia
  Chronic renal failure
  Clear cell renal carcinoma
  Fetal growth restriction
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
• UniProt ID: ARNT_HUMAN
• PDB ID: 1X0O; 2A24; 2B02; 2HV1; 2K7S; 3F1N; 3F1O; 3F1P; 3H7W; 3H82; 4EQ1; 4GHI; 4GS9; 4H6J; 4LPZ; 4PKY; 4XT2; 5TBM; 5UFP; 5V0L; 6CZW; 6D09; 6D0B; 6D0C; 6X21; 6X28; 6X2H; 6X37; 6X3D; 8CK3; 8CK4; 8CK8
• Pfam ID: PF00010 ; PF00989 ; PF14598
• Sequence:
  MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
  RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
  ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
  CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
  TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
  PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
  TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
  QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
  RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
  PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
  RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKT
  RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
  EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
  LTMFPPFSE
• Function: Required for activity of the AHR. Upon ligand binding, AHR translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Not required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex initiates transcription of genes involved in the regulation of a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation (Probable). The heterodimer binds to core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) of target gene promoters and functions as a transcriptional regulator of the adaptive response to hypoxia. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription.
• KEGG Pathway:
  HIF-1 sig.ling pathway (hsa04066)
  Efferocytosis (hsa04148)
  Cushing syndrome (hsa04934)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Re.l cell carcinoma (hsa05211)
• Reactome Pathway:
  PPARA activates gene expression (R-HSA-1989781)
  Phase I - Functionalization of compounds (R-HSA-211945)
  Endogenous sterols (R-HSA-211976)
  Xenobiotics (R-HSA-211981)
  Aryl hydrocarbon receptor signalling (R-HSA-8937144)
  NPAS4 regulates expression of target genes (R-HSA-9768919)
  Regulation of gene expression by Hypoxia-inducible Factor (R-HSA-1234158)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anaplastic large cell lymphoma	DISP4D1R	Strong	Biomarker	[1]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[2]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[3]
Colon cancer	DISVC52G	Strong	Altered Expression	[4]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[4]
Colorectal adenoma	DISTSVHM	Strong	Genetic Variation	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[6]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[5]
Cutaneous melanoma	DIS3MMH9	Strong	Altered Expression	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[8]
Essential hypertension	DIS7WI98	Strong	Genetic Variation	[9]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[10]
Gastrointestinal stromal tumour	DIS6TJYS	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[12]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[8]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[13]
Melanoma	DIS1RRCY	Strong	Altered Expression	[14]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[6]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[10]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[10]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[15]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[8]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[8]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[16]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[17]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[8]
Age-related macular degeneration	DIS0XS2C	moderate	Genetic Variation	[18]
Breast cancer	DIS7DPX1	moderate	Altered Expression	[19]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[19]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[20]
Hypoglycemia	DISRCKR7	moderate	Biomarker	[21]
Liver cancer	DISDE4BI	moderate	Biomarker	[20]
Meningioma	DISPT4TG	moderate	Altered Expression	[22]
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[23]
Small lymphocytic lymphoma	DIS30POX	moderate	Genetic Variation	[24]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[25]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[6]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Limited	Biomarker	[26]
Chronic renal failure	DISGG7K6	Limited	Altered Expression	[27]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[28]
Fetal growth restriction	DIS5WEJ5	Limited	Biomarker	[29]
Prostate cancer	DISF190Y	Limited	Biomarker	[30]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[30]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[28]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[43]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[32]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[33]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[34]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[35]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[36]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[37]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[38]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[36]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[39]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[42]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[44]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[45]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[46]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[47]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[38]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid increases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[48]
Buthionine sulfoximine	DMJ46CB	Investigative	Buthionine sulfoximine decreases the expression of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[35]

4 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Omeprazole	DM471KJ	Approved	Omeprazole affects the localization of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[40]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the localization of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[41]
Acteoside	DM0YHKB	Terminated	Acteoside increases the localization of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[41]
Rutin	DMEHRAJ	Investigative	Rutin increases the localization of Aryl hydrocarbon receptor nuclear translocator (ARNT).	[41]

References

• [1] The aryl hydrocarbon nuclear translocator alters CD30-mediated NF-kappaB-dependent transcription.Science. 2009 Jan 9;323(5911):251-5. doi: 10.1126/science.1162818.
• [2] BCL6--regulated by AhR/ARNT and wild-type MEF2B--drives expression of germinal center markers MYBL1 and LMO2.Haematologica. 2015 Jun;100(6):801-9. doi: 10.3324/haematol.2014.120048. Epub 2015 Mar 13.
• [3] Computational pathology of pre-treatment biopsies identifies lymphocyte density as a predictor of response to neoadjuvant chemotherapy in breast cancer.Breast Cancer Res. 2016 Feb 16;18(1):21. doi: 10.1186/s13058-016-0682-8.
• [4] P53-induced microRNA-107 inhibits HIF-1 and tumor angiogenesis.Proc Natl Acad Sci U S A. 2010 Apr 6;107(14):6334-9. doi: 10.1073/pnas.0911082107. Epub 2010 Mar 22.
• [5] Genetic variation in the bioactivation pathway for polycyclic hydrocarbons and heterocyclic amines in relation to risk of colorectal neoplasia.Carcinogenesis. 2011 Feb;32(2):203-9. doi: 10.1093/carcin/bgq237. Epub 2010 Nov 16.
• [6] Down-regulation of ARNT promotes cancer metastasis by activating the fibronectin/integrin 1/FAK axis.Oncotarget. 2015 May 10;6(13):11530-46. doi: 10.18632/oncotarget.3448.
• [7] Hypoxic Gene Signature of Primary and Metastatic Melanoma Cell Lines: Focusing on HIF-1 and NDRG-1.Balkan Med J. 2019 Dec 20;37(1):15-23. doi: 10.4274/balkanmedj.galenos.2019.2019.3.145. Epub 2019 Oct 9.
• [8] Uterine and ovarian aryl hydrocarbon receptor (AHR) and aryl hydrocarbon receptor nuclear translocator (ARNT) mRNA expression in benign and malignant gynaecological conditions.Mol Hum Reprod. 2002 Jan;8(1):75-80. doi: 10.1093/molehr/8.1.75.
• [9] A comprehensive contribution of genes for aryl hydrocarbon receptor signaling pathway to hypertension susceptibility.Pharmacogenet Genomics. 2017 Feb;27(2):57-69. doi: 10.1097/FPC.0000000000000261.
• [10] Myeloid cell deletion of Aryl hydrocarbon Receptor Nuclear Translocator (ARNT) induces non-alcoholic steatohepatitis.PLoS One. 2019 Dec 4;14(12):e0225332. doi: 10.1371/journal.pone.0225332. eCollection 2019.
• [11] Correction to: Histone demethylase KDM4D promotes gastrointestinal stromal tumor progression through HIF1/VEGFA signalling.Mol Cancer. 2018 Sep 13;17(1):135. doi: 10.1186/s12943-018-0885-y.
• [12] Silencing of hypoxia-inducible factor-1 induces anti-tumor effects in hepatoma cell lines under tumor hypoxia.PLoS One. 2014 Jul 28;9(7):e103304. doi: 10.1371/journal.pone.0103304. eCollection 2014.
• [13] Hypoxia-inducible factor activation in myeloid cells contributes to the development of liver fibrosis in cholestatic mice.J Pharmacol Exp Ther. 2012 May;341(2):307-16. doi: 10.1124/jpet.111.189340. Epub 2012 Jan 23.
• [14] Systems analysis of barrier molecule and ARNT-related gene expression regulation in melanoma.Oncoimmunology. 2019 Sep 24;8(12):e1665978. doi: 10.1080/2162402X.2019.1665978. eCollection 2019.
• [15] The Loss of ARNT/HIF1 in Male Pancreatic -Cells Is Protective Against High-Fat Diet-Induced Diabetes.Endocrinology. 2019 Dec 1;160(12):2825-2836. doi: 10.1210/en.2018-00936.
• [16] The aryl hydrocarbon receptor (AhR) inhibits vanadate-induced vascular endothelial growth factor (VEGF) production in TRAMP prostates.Carcinogenesis. 2008 May;29(5):1077-82. doi: 10.1093/carcin/bgn069. Epub 2008 Mar 20.
• [17] Comprehensive analysis of polymorphisms throughout GAD1 gene: a family-based association study in schizophrenia.J Neural Transm (Vienna). 2008;115(3):513-9. doi: 10.1007/s00702-007-0844-z. Epub 2008 Mar 12.
• [18] Transcriptome Analysis on Monocytes from Patients with Neovascular Age-Related Macular Degeneration.Sci Rep. 2016 Jul 4;6:29046. doi: 10.1038/srep29046.
• [19] Expression of HIF-1 and Markers of Angiogenesis Are Not Significantly Different in Triple Negative Breast Cancer Compared to Other Breast Cancer Molecular Subtypes: Implications for Future Therapy.PLoS One. 2015 Jun 5;10(6):e0129356. doi: 10.1371/journal.pone.0129356. eCollection 2015.
• [20] Transcriptional regulation of urokinase-type plasminogen activator receptor by hypoxia-inducible factor 1 is crucial for invasion of pancreatic and liver cancer.Neoplasia. 2009 Feb;11(2):196-206. doi: 10.1593/neo.08734.
• [21] A protective role for HIF-1 in response to redox manipulation and glucose deprivation: implications for tumorigenesis.Oncogene. 2002 Jan 10;21(2):282-90. doi: 10.1038/sj.onc.1205047.
• [22] Overexpression of aryl hydrocarbon receptor (AHR) signalling pathway in human meningioma.J Neurooncol. 2018 Apr;137(2):241-248. doi: 10.1007/s11060-017-2730-3. Epub 2018 Jan 4.
• [23] ARNT/HIF-1 links high-risk 1q21 gain and microenvironmental hypoxia to drug resistance and poor prognosis in multiple myeloma.Cancer Med. 2018 Aug;7(8):3899-3911. doi: 10.1002/cam4.1596. Epub 2018 Jun 21.
• [24] Chronic lymphocytic leukemia in a child: a challenging diagnosis in pediatric oncology practice.Pediatr Blood Cancer. 2014 May;61(5):933-5. doi: 10.1002/pbc.24865. Epub 2013 Nov 19.
• [25] Up-regulation of PER3 Expression Is Correlated with Better Clinical Outcome in Acute Leukemia.Anticancer Res. 2015 Dec;35(12):6615-22.
• [26] Variation in xenobiotic transport and metabolism genes, household chemical exposures, and risk of childhood acute lymphoblastic leukemia.Cancer Causes Control. 2012 Aug;23(8):1367-75. doi: 10.1007/s10552-012-9947-4. Epub 2012 Jun 7.
• [27] Pharmacological induction of hypoxia-inducible transcription factor ARNT attenuates chronic kidney failure.J Clin Invest. 2018 Jul 2;128(7):3053-3070. doi: 10.1172/JCI89632. Epub 2018 Jun 11.
• [28] Pharmacologic Targeting of Hypoxia-Inducible Factors.Annu Rev Pharmacol Toxicol. 2019 Jan 6;59:379-403. doi: 10.1146/annurev-pharmtox-010818-021637.
• [29] Overexpression of the aryl hydrocarbon receptor nuclear translocator partially rescues fetoplacental angiogenesis in severe fetal growth restriction.Clin Sci (Lond). 2019 Jun 20;133(12):1353-1365. doi: 10.1042/CS20190381. Print 2019 Jun 28.
• [30] Aromatic Hydrocarbon Receptor Suppresses Prostate Cancer Bone Metastasis Cells-Induced Vasculogenesis of Endothelial Progenitor Cells under Hypoxia.Cell Physiol Biochem. 2016;39(2):709-20. doi: 10.1159/000445662. Epub 2016 Jul 25.
• [31] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [34] Single and concerted effects of benzo[a]pyrene and flavonoids on the AhR and Nrf2-pathway in the human colon carcinoma cell line Caco-2. Toxicol In Vitro. 2011 Apr;25(3):671-83.
• [35] Curcumin inhibits hypoxia-inducible factor-1 by degrading aryl hydrocarbon receptor nuclear translocator: a mechanism of tumor growth inhibition. Mol Pharmacol. 2006 Nov;70(5):1664-71. doi: 10.1124/mol.106.025817. Epub 2006 Jul 31.
• [36] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [37] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [38] Ligand-independent activation of AhR by hydroquinone mediates benzene-induced hematopoietic toxicity. Chem Biol Interact. 2022 Mar 1;355:109845. doi: 10.1016/j.cbi.2022.109845. Epub 2022 Feb 4.
• [39] A fine-needle aspirate-based vulnerability assay identifies polo-like kinase 1 as a mediator of gemcitabine resistance in pancreatic cancer. Mol Cancer Ther. 2010 Feb;9(2):311-8. doi: 10.1158/1535-7163.MCT-09-0693. Epub 2010 Jan 26.
• [40] Omeprazole inhibits pancreatic cancer cell invasion through a nongenomic aryl hydrocarbon receptor pathway. Chem Res Toxicol. 2015 May 18;28(5):907-18.
• [41] Plant polyphenols differentially modulate inflammatory responses of human keratinocytes by interfering with activation of transcription factors NFB and AhR and EGFR-ERK pathway. Toxicol Appl Pharmacol. 2011 Sep 1;255(2):138-49.
• [42] EF24, a novel curcumin analog, disrupts the microtubule cytoskeleton and inhibits HIF-1. Cell Cycle. 2008 Aug;7(15):2409-17. doi: 10.4161/cc.6410. Epub 2008 Jun 9.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Induction and activation of the aryl hydrocarbon receptor by IL-4 in B cells. Int Immunol. 2005 Jun;17(6):797-805. doi: 10.1093/intimm/dxh260. Epub 2005 May 17.
• [45] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [46] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [47] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [48] Compounds of PAH mixtures dependent interaction between multiple signaling pathways in granulosa tumour cells. Toxicol Lett. 2019 Aug;310:14-22. doi: 10.1016/j.toxlet.2019.04.008. Epub 2019 Apr 10.