Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMVZCPW)

DOT Name Myeloid zinc finger 1 (MZF1)
Synonyms MZF-1; Zinc finger and SCAN domain-containing protein 6; Zinc finger protein 42
Gene Name MZF1
Related Disease
Alzheimer disease ( )
Asthma ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Colon cancer ( )
Colorectal adenocarcinoma ( )
Colorectal adenoma ( )
Colorectal cancer ( )
Colorectal cancer, susceptibility to, 1 ( )
Colorectal cancer, susceptibility to, 10 ( )
Colorectal cancer, susceptibility to, 12 ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Diabetic kidney disease ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Hepatocellular carcinoma ( )
Melanoma ( )
Neuralgia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Seasonal allergic rhinitis ( )
Systemic lupus erythematosus ( )
T-cell lymphoma ( )
leukaemia ( )
Leukemia ( )
Lung cancer ( )
Promyelocytic leukaemia ( )
Squamous cell carcinoma ( )
Bladder transitional cell carcinoma ( )
Tarsal-carpal coalition syndrome ( )
Advanced cancer ( )
Cervical cancer ( )
Cervical carcinoma ( )
Gastric cancer ( )
Neuroblastoma ( )
Stomach cancer ( )
Stroke ( )
Triple negative breast cancer ( )
UniProt ID
MZF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2FI2
Pfam ID
PF02023 ; PF00096
Sequence
MRPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFRYEEATGPQE
ALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVD
GLRREPGGPRRWVTVQVQGQEVLSEKMEPSSFQPLPETEPPTPEPGPKTPPRTMQESPLG
LQVKEESEVTEDSDFLESGPLAATQESVPTLLPEEAQRCGTVLDQIFPHSKTGPEGPSWR
EHPRALWHEEAGGIFSPGFALQLGSISAGPGSVSPHLHVPWDLGMAGLSGQIQSPSREGG
FAHALLLPSDLRSEQDPTDEDPCRGVGPALITTRWRSPRGRSRGRPSTGGGVVRGGRCDV
CGKVFSQRSNLLRHQKIHTGERPFVCSECGRSFSRSSHLLRHQLTHTEERPFVCGDCGQG
FVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPE
PPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGERP
FACAECGQSFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKPFACP
ECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQ
SFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQ
STKLIQHQRVHSAE
Function
Binds to target promoter DNA and functions as a transcription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development.
Tissue Specificity Preferentially expressed in differentiating myeloid cells. Detected in osteoblasts.

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Genetic Variation [1]
Asthma DISW9QNS Strong Genetic Variation [2]
Breast cancer DIS7DPX1 Strong Altered Expression [3]
Breast carcinoma DIS2UE88 Strong Altered Expression [3]
Breast neoplasm DISNGJLM Strong Altered Expression [3]
Colon cancer DISVC52G Strong Genetic Variation [4]
Colorectal adenocarcinoma DISPQOUB Strong Genetic Variation [4]
Colorectal adenoma DISTSVHM Strong Genetic Variation [4]
Colorectal cancer DISNH7P9 Strong Genetic Variation [4]
Colorectal cancer, susceptibility to, 1 DISZ794C Strong Genetic Variation [4]
Colorectal cancer, susceptibility to, 10 DISQXMYM Strong Genetic Variation [4]
Colorectal cancer, susceptibility to, 12 DIS4FXJX Strong Genetic Variation [4]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [4]
Colorectal neoplasm DISR1UCN Strong Genetic Variation [4]
Diabetic kidney disease DISJMWEY Strong Altered Expression [5]
Endometrial cancer DISW0LMR Strong Altered Expression [6]
Endometrial carcinoma DISXR5CY Strong Altered Expression [6]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [7]
Melanoma DIS1RRCY Strong Biomarker [8]
Neuralgia DISWO58J Strong Biomarker [9]
Prostate cancer DISF190Y Strong Biomarker [10]
Prostate carcinoma DISMJPLE Strong Biomarker [10]
Prostate neoplasm DISHDKGQ Strong Biomarker [11]
Seasonal allergic rhinitis DIS58KQX Strong Genetic Variation [2]
Systemic lupus erythematosus DISI1SZ7 Strong Genetic Variation [12]
T-cell lymphoma DISSXRTQ Strong Biomarker [13]
leukaemia DISS7D1V moderate Biomarker [14]
Leukemia DISNAKFL moderate Biomarker [14]
Lung cancer DISCM4YA moderate Altered Expression [15]
Promyelocytic leukaemia DISYGG13 moderate Posttranslational Modification [14]
Squamous cell carcinoma DISQVIFL moderate Altered Expression [16]
Bladder transitional cell carcinoma DISNL46A Disputed Altered Expression [17]
Tarsal-carpal coalition syndrome DISY90L2 Disputed Altered Expression [17]
Advanced cancer DISAT1Z9 Limited Posttranslational Modification [18]
Cervical cancer DISFSHPF Limited Altered Expression [19]
Cervical carcinoma DIST4S00 Limited Altered Expression [19]
Gastric cancer DISXGOUK Limited Altered Expression [20]
Neuroblastoma DISVZBI4 Limited Biomarker [21]
Stomach cancer DISKIJSX Limited Altered Expression [20]
Stroke DISX6UHX Limited Biomarker [22]
Triple negative breast cancer DISAMG6N Limited Biomarker [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Calcitriol DM8ZVJ7 Approved Myeloid zinc finger 1 (MZF1) increases the response to substance of Calcitriol. [33]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Myeloid zinc finger 1 (MZF1). [24]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the methylation of Myeloid zinc finger 1 (MZF1). [25]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Myeloid zinc finger 1 (MZF1). [27]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Myeloid zinc finger 1 (MZF1). [30]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Myeloid zinc finger 1 (MZF1). [31]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Myeloid zinc finger 1 (MZF1). [26]
Selenium DM25CGV Approved Selenium increases the expression of Myeloid zinc finger 1 (MZF1). [28]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Myeloid zinc finger 1 (MZF1). [29]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Myeloid zinc finger 1 (MZF1). [32]
------------------------------------------------------------------------------------

References

1 Haplotype of single nucleotide polymorphisms in exon 6 of the MZF-1 gene and Alzheimer's disease.J Alzheimers Dis. 2013;34(2):439-47. doi: 10.3233/JAD-121546.
2 Twin concordance for a binary trait: III. A bivariate analysis of hay fever and asthma.Genet Epidemiol. 1990;7(4):277-89. doi: 10.1002/gepi.1370070406.
3 Release of transcriptional repression via ErbB2-induced, SUMO-directed phosphorylation of myeloid zinc finger-1 serine 27 activates lysosome redistribution and invasion.Oncogene. 2019 Apr;38(17):3170-3184. doi: 10.1038/s41388-018-0653-x. Epub 2019 Jan 8.
4 Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
5 Bioinformatic Evaluation of Transcriptional Regulation of WNT Pathway Genes with reference to Diabetic Nephropathy.J Diabetes Res. 2016;2016:7684038. doi: 10.1155/2016/7684038. Epub 2015 Nov 30.
6 DNA methylation promotes paired box 2 expression via myeloid zinc finger 1 in endometrial cancer.Oncotarget. 2016 Dec 20;7(51):84785-84797. doi: 10.18632/oncotarget.12626.
7 Deficiency in Embryonic Stem Cell Marker Reduced Expression 1 Activates Mitogen-Activated Protein Kinase Kinase 6-Dependent p38 Mitogen-Activated Protein Kinase Signaling to Drive Hepatocarcinogenesis.Hepatology. 2020 Jul;72(1):183-197. doi: 10.1002/hep.31020. Epub 2020 Apr 8.
8 Tumor antigen PRAME is up-regulated by MZF1 in cooperation with DNA hypomethylation in melanoma cells. Cancer Lett. 2017 Sep 10;403:144-151.
9 MZF1 in the Dorsal Root Ganglia Contributes to the Development and Maintenance of Neuropathic Pain via Regulation of TRPV1.Neural Plast. 2019 Sep 8;2019:2782417. doi: 10.1155/2019/2782417. eCollection 2019.
10 MZF1 and SCAND1 Reciprocally Regulate CDC37 Gene Expression in Prostate Cancer.Cancers (Basel). 2019 Jun 8;11(6):792. doi: 10.3390/cancers11060792.
11 Myeloid zinc-finger 1 (MZF-1) suppresses prostate tumor growth through enforcing ferroportin-conducted iron egress.Oncogene. 2015 Jul;34(29):3839-47. doi: 10.1038/onc.2014.310. Epub 2014 Oct 6.
12 Programmed cell death 1 genotypes are associated with susceptibility to systemic lupus erythematosus among Chinese.Arch Dermatol Res. 2008 Feb;300(2):91-3. doi: 10.1007/s00403-007-0814-1. Epub 2007 Nov 13.
13 The transcription factors Ik-1 and MZF1 downregulate IGF-IR expression in NPM-ALK?T-cell lymphoma.Mol Cancer. 2015 Feb 25;14:53. doi: 10.1186/s12943-015-0324-2.
14 Role and Regulation of Myeloid Zinc Finger Protein 1 in Cancer.J Cell Biochem. 2015 Oct;116(10):2146-54. doi: 10.1002/jcb.25203.
15 MZF-1/Elk-1/PKC is Associated with Poor Prognosis in Patients with Hepatocellular Carcinoma.J Cancer. 2017 Sep 2;8(15):3028-3036. doi: 10.7150/jca.20467. eCollection 2017.
16 Expression of myeloid zinc finger 1 and the correlation to clinical aspects of oral squamous cell carcinoma.Tumour Biol. 2015 Sep;36(9):7099-105. doi: 10.1007/s13277-015-3419-x. Epub 2015 Apr 16.
17 Expression of protein kinase C and the MZF-1 and elk-1 transcription factors in human bladder transitional cell carcinoma cells.Chin J Physiol. 2012 Apr 30;55(2):75-81. doi: 10.4077/CJP.2012.AMM121.
18 Myeloid zinc finger-1 regulates expression of cancer-associated fibroblast and cancer stemness profiles in breast cancer.Surgery. 2019 Oct;166(4):515-523. doi: 10.1016/j.surg.2019.05.042. Epub 2019 Jul 10.
19 Overexpression of myeloid zinc finger 1 suppresses matrix metalloproteinase-2 expression and reduces invasiveness of SiHa human cervical cancer cells. Biochem Biophys Res Commun. 2012 Aug 24;425(2):462-7.
20 Transcription Factor Myeloid Zinc-Finger 1 Suppresses Human Gastric Carcinogenesis by Interacting with Metallothionein 2A.Clin Cancer Res. 2019 Feb 1;25(3):1050-1062. doi: 10.1158/1078-0432.CCR-18-1281. Epub 2018 Oct 9.
21 Therapeutic Targeting of MZF1-AS1/PARP1/E2F1 Axis Inhibits Proline Synthesis and Neuroblastoma Progression.Adv Sci (Weinh). 2019 Aug 10;6(19):1900581. doi: 10.1002/advs.201900581. eCollection 2019 Oct 2.
22 Neuroprotective activity of leukemia inhibitory factor is relayed through myeloid zinc finger-1 in a rat model of stroke.Metab Brain Dis. 2019 Apr;34(2):631-640. doi: 10.1007/s11011-018-0376-2. Epub 2019 Jan 5.
23 Myeloid Zinc Finger 1 (MZF1) Maintains the Mesenchymal Phenotype by Down-regulating IGF1R/p38 MAPK/ER Signaling Pathway in High-level MZF1-expressing TNBC cells.Anticancer Res. 2019 Aug;39(8):4149-4164. doi: 10.21873/anticanres.13574.
24 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
25 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
26 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
27 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
28 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
29 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
30 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
31 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
32 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
33 Myeloid cell differentiation in response to calcitriol for expression CD11b and CD14 is regulated by myeloid zinc finger-1 protein downstream of phosphatidylinositol 3-kinase. J Leukoc Biol. 2008 Aug;84(2):519-28. doi: 10.1189/jlb.1207833. Epub 2008 Jun 17.