Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNRRD8I)

DOT Name Nuclear factor NF-kappa-B p105 subunit (NFKB1)
Synonyms DNA-binding factor KBF1; EBP-1; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Gene Name NFKB1
Related Disease
Immunodeficiency, common variable, 12 ( )
Common variable immunodeficiency ( )
UniProt ID
NFKB1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1MDI; 1MDJ; 1MDK; 1NFI; 1SVC; 2DBF; 2O61; 3GUT; 7LEQ; 7LET; 7LF4; 7LFC; 7RG4; 7RG5
Pfam ID
PF00023 ; PF12796 ; PF00531 ; PF16179 ; PF00554
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
Function
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and RelB-p50 complexes are transcriptional activators. The NF-kappa-B p50-p50 homodimer is a transcriptional repressor, but can act as a transcriptional activator when associated with BCL3. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. The proteasome-mediated process ensures the production of both p50 and p105 and preserves their independent function, although processing of NFKB1/p105 also appears to occur post-translationally. p50 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. In a complex with MAP3K8, NFKB1/p105 represses MAP3K8-induced MAPK signaling; active MAP3K8 is released by proteasome-dependent degradation of NFKB1/p105; [Nuclear factor NF-kappa-B p105 subunit]: P105 is the precursor of the active p50 subunit (Nuclear factor NF-kappa-B p50 subunit) of the nuclear factor NF-kappa-B. Acts as a cytoplasmic retention of attached NF-kappa-B proteins by p105 ; [Nuclear factor NF-kappa-B p50 subunit]: Constitutes the active form, which associates with RELA/p65 to form the NF-kappa-B p65-p50 complex to form a transcription factor. Together with RELA/p65, binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions.
KEGG Pathway
Antifolate resistance (hsa01523 )
MAPK sig.ling pathway (hsa04010 )
Ras sig.ling pathway (hsa04014 )
cAMP sig.ling pathway (hsa04024 )
Chemokine sig.ling pathway (hsa04062 )
NF-kappa B sig.ling pathway (hsa04064 )
HIF-1 sig.ling pathway (hsa04066 )
Sphingolipid sig.ling pathway (hsa04071 )
PI3K-Akt sig.ling pathway (hsa04151 )
Apoptosis (hsa04210 )
Longevity regulating pathway (hsa04211 )
Cellular senescence (hsa04218 )
Osteoclast differentiation (hsa04380 )
Neutrophil extracellular trap formation (hsa04613 )
Toll-like receptor sig.ling pathway (hsa04620 )
NOD-like receptor sig.ling pathway (hsa04621 )
RIG-I-like receptor sig.ling pathway (hsa04622 )
Cytosolic D.-sensing pathway (hsa04623 )
C-type lectin receptor sig.ling pathway (hsa04625 )
IL-17 sig.ling pathway (hsa04657 )
Th1 and Th2 cell differentiation (hsa04658 )
Th17 cell differentiation (hsa04659 )
T cell receptor sig.ling pathway (hsa04660 )
B cell receptor sig.ling pathway (hsa04662 )
TNF sig.ling pathway (hsa04668 )
Neurotrophin sig.ling pathway (hsa04722 )
Prolactin sig.ling pathway (hsa04917 )
Adipocytokine sig.ling pathway (hsa04920 )
Relaxin sig.ling pathway (hsa04926 )
Insulin resistance (hsa04931 )
Non-alcoholic fatty liver disease (hsa04932 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Alcoholic liver disease (hsa04936 )
Alzheimer disease (hsa05010 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Cocaine addiction (hsa05030 )
Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Pertussis (hsa05133 )
Legionellosis (hsa05134 )
Yersinia infection (hsa05135 )
Leishmaniasis (hsa05140 )
Chagas disease (hsa05142 )
Toxoplasmosis (hsa05145 )
Amoebiasis (hsa05146 )
Tuberculosis (hsa05152 )
Hepatitis C (hsa05160 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coro.virus disease - COVID-19 (hsa05171 )
Pathways in cancer (hsa05200 )
Transcriptio.l misregulation in cancer (hsa05202 )
Viral carcinogenesis (hsa05203 )
MicroR.s in cancer (hsa05206 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Pancreatic cancer (hsa05212 )
Prostate cancer (hsa05215 )
Chronic myeloid leukemia (hsa05220 )
Acute myeloid leukemia (hsa05221 )
Small cell lung cancer (hsa05222 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Inflammatory bowel disease (hsa05321 )
Diabetic cardiomyopathy (hsa05415 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
RIP-mediated NFkB activation via ZBP1 (R-HSA-1810476 )
Regulated proteolysis of p75NTR (R-HSA-193692 )
Downstream TCR signaling (R-HSA-202424 )
NF-kB is activated and signals survival (R-HSA-209560 )
Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
FCERI mediated NF-kB activation (R-HSA-2871837 )
DEx/H-box helicases activate type I IFN and inflammatory cytokines production (R-HSA-3134963 )
PKMTs methylate histone lysines (R-HSA-3214841 )
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989 )
Interleukin-1 processing (R-HSA-448706 )
IkBA variant leads to EDA-ID (R-HSA-5603029 )
CLEC7A (Dectin-1) signaling (R-HSA-5607764 )
CD209 (DC-SIGN) signaling (R-HSA-5621575 )
CLEC7A/inflammasome pathway (R-HSA-5660668 )
MAP3K8 (TPL2)-dependent MAPK1/3 activation (R-HSA-5684264 )
Neutrophil degranulation (R-HSA-6798695 )
The NLRP3 inflammasome (R-HSA-844456 )
Transcriptional Regulation by VENTX (R-HSA-8853884 )
Interleukin-1 signaling (R-HSA-9020702 )
TRAF6 mediated NF-kB activation (R-HSA-933542 )
HCMV Early Events (R-HSA-9609690 )
Purinergic signaling in leishmaniasis infection (R-HSA-9660826 )
SARS-CoV-1 activates/modulates innate immune responses (R-HSA-9692916 )
Regulation of NFE2L2 gene expression (R-HSA-9818749 )
Activation of NF-kappaB in B cells (R-HSA-1169091 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Immunodeficiency, common variable, 12 DISQYNQR Definitive Autosomal dominant [1]
Common variable immunodeficiency DISHE7JQ Supportive Autosomal dominant [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Paclitaxel DMLB81S Approved Nuclear factor NF-kappa-B p105 subunit (NFKB1) increases the Apoptosis ADR of Paclitaxel. [88]
Amphotericin B DMTAJQE Approved Nuclear factor NF-kappa-B p105 subunit (NFKB1) increases the Neurotoxicity ADR of Amphotericin B. [88]
Deoxycholic acid DM3GYAL Approved Nuclear factor NF-kappa-B p105 subunit (NFKB1) decreases the response to substance of Deoxycholic acid. [89]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [3]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the phosphorylation of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [17]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [68]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [71]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [68]
------------------------------------------------------------------------------------
84 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [9]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [10]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [12]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [13]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [14]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [15]
Menadione DMSJDTY Approved Menadione affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [16]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [18]
Folic acid DMEMBJC Approved Folic acid affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [19]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [21]
Troglitazone DM3VFPD Approved Troglitazone decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [22]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [23]
Aspirin DM672AH Approved Aspirin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [24]
Irinotecan DMP6SC2 Approved Irinotecan increases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [25]
Diclofenac DMPIHLS Approved Diclofenac decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [14]
Nicotine DMWX5CO Approved Nicotine increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [26]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [27]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [14]
Menthol DMG2KW7 Approved Menthol decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [28]
Simvastatin DM30SGU Approved Simvastatin decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [29]
Obeticholic acid DM3Q1SM Approved Obeticholic acid increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [30]
Sulindac DM2QHZU Approved Sulindac decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [32]
Capsaicin DMGMF6V Approved Capsaicin affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [33]
Methamphetamine DMPM4SK Approved Methamphetamine increases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [34]
Phenytoin DMNOKBV Approved Phenytoin increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [35]
Hydroxyurea DMOQVU9 Approved Hydroxyurea decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [36]
Gefitinib DM15F0X Approved Gefitinib decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [37]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [38]
Sertraline DM0FB1J Approved Sertraline increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [39]
Ritonavir DMU764S Approved Ritonavir decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [40]
Dactinomycin DM2YGNW Approved Dactinomycin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [41]
2-deoxyglucose DMIAHVU Approved 2-deoxyglucose decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [43]
Dihydroxyacetone DMM1LG2 Approved Dihydroxyacetone decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [44]
Romidepsin DMT5GNL Approved Romidepsin increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [45]
Sulfasalazine DMICA9H Approved Sulfasalazine decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [47]
Busulfan DMXYJ9C Approved Busulfan increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [48]
Terbutaline DMD4381 Approved Terbutaline decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [50]
Diazoxide DML1538 Approved Diazoxide increases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [51]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [5]
Curcumin DMQPH29 Phase 3 Curcumin decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [53]
Chloroquine DMSI5CB Phase 3 Trial Chloroquine decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [20]
Napabucasin DMDZ6Q3 Phase 3 Napabucasin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [54]
I3C DMIGFOR Phase 3 I3C decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [55]
MLN4924 DMP36KD Phase 3 MLN4924 affects the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [56]
Nabiximols DMHKJ5I Phase 3 Nabiximols decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [57]
Abexinostat DM91LGU Phase 3 Abexinostat decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [58]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [48]
Phenol DM1QSM3 Phase 2/3 Phenol increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [27]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [59]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [45]
DNCB DMDTVYC Phase 2 DNCB decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [27]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [60]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [61]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [48]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [64]
AMEP DMFELMQ Phase 1 AMEP increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [65]
PF-3758309 DM36PKZ Phase 1 PF-3758309 decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [66]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [67]
Eugenol DM7US1H Patented Eugenol affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [27]
Ciglitazone DMAPO0T Preclinical Ciglitazone decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [22]
Piperlongumine DMIZCOE Preclinical Piperlongumine decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [69]
B-581 DM5EKPM Terminated B-581 decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [70]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [72]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [73]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [74]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [75]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [36]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [76]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [77]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [78]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [13]
Butanoic acid DMTAJP7 Investigative Butanoic acid decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [79]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [27]
crotylaldehyde DMTWRQI Investigative crotylaldehyde affects the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [80]
acrolein DMAMCSR Investigative acrolein decreases the activity of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [81]
Cycloheximide DMGDA3C Investigative Cycloheximide increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [82]
Cordycepin DM72Y01 Investigative Cordycepin decreases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [83]
BRN-3548355 DM4KXT0 Investigative BRN-3548355 increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [84]
Linalool DMGZQ5P Investigative Linalool increases the expression of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [85]
------------------------------------------------------------------------------------
⏷ Show the Full List of 84 Drug(s)
11 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [7]
Niclosamide DMJAGXQ Approved Niclosamide affects the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [20]
Fenofibrate DMFKXDY Approved Fenofibrate affects the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [31]
Ximelegatran DMU8ANS Approved Ximelegatran affects the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [42]
Ergotidine DM78IME Approved Ergotidine affects the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [46]
Norepinephrine DMOUC09 Approved Norepinephrine affects the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [49]
Oestradiol valerate and dienogest DMZK0FQ Approved Oestradiol valerate and dienogest affects the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [52]
BAICALEIN DM4C7E6 Phase 2 BAICALEIN decreases the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [62]
PIPERINE DMYEAB1 Phase 1/2 PIPERINE decreases the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [63]
Apigenin DMI3491 Investigative Apigenin affects the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [86]
15-deoxy-Delta(12, 14)-prostaglandin J(2) DM8VUX3 Investigative 15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the localization of Nuclear factor NF-kappa-B p105 subunit (NFKB1). [87]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Haploinsufficiency of the NF-B1 Subunit p50 in Common Variable Immunodeficiency. Am J Hum Genet. 2015 Sep 3;97(3):389-403. doi: 10.1016/j.ajhg.2015.07.008. Epub 2015 Aug 13.
3 Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Resveratrol improves the anticancer effects of doxorubicin in vitro and in vivo models: a mechanistic insight. Phytomedicine. 2016 Mar 15;23(3):233-42.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Phosphorylated TP63 induces transcription of RPN13, leading to NOS2 protein degradation. J Biol Chem. 2010 Dec 31;285(53):41422-31. doi: 10.1074/jbc.M110.158642. Epub 2010 Oct 19.
8 Reciprocal regulation of 17beta-estradiol, interleukin-6 and interleukin-8 during growth and progression of epithelial ovarian cancer. Cytokine. 2009 Jun;46(3):382-91. doi: 10.1016/j.cyto.2009.03.013. Epub 2009 Apr 28.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Genome-wide analysis of BEAS-2B cells exposed to trivalent arsenicals and dimethylthioarsinic acid. Toxicology. 2010 Jan 31;268(1-2):31-9.
11 Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
12 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
13 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
14 Development of an alternative zebrafish model for drug-induced intestinal toxicity. J Appl Toxicol. 2018 Feb;38(2):259-273. doi: 10.1002/jat.3520. Epub 2017 Oct 13.
15 Silencing of the CKII alpha and CKII alpha' genes during cellular senescence is mediated by DNA methylation. Gene. 2009 Feb 15;431(1-2):55-60. doi: 10.1016/j.gene.2008.10.020. Epub 2008 Nov 6.
16 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
17 Resveratrol induces chemosensitization to 5-fluorouracil through up-regulation of intercellular junctions, Epithelial-to-mesenchymal transition and apoptosis in colorectal cancer. Biochem Pharmacol. 2015 Nov 1;98(1):51-68. doi: 10.1016/j.bcp.2015.08.105. Epub 2015 Aug 24.
18 Dexamethasone and the inflammatory response in explants of human omental adipose tissue. Mol Cell Endocrinol. 2010 Feb 5;315(1-2):292-8.
19 Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
20 Niclosamide, an anti-helminthic molecule, downregulates the retroviral oncoprotein Tax and pro-survival Bcl-2 proteins in HTLV-1-transformed T lymphocytes. Biochem Biophys Res Commun. 2015 Aug 14;464(1):221-228. doi: 10.1016/j.bbrc.2015.06.120. Epub 2015 Jun 23.
21 Bortezomib and Arsenic Trioxide Activity on a Myelodysplastic Cell Line (P39): A Gene Expression Study. Turk J Haematol. 2015 Sep;32(3):206-12. doi: 10.4274/tjh.2014.0058.
22 Peroxisome proliferator-activated receptor-gamma agonists inhibit respiratory syncytial virus-induced expression of intercellular adhesion molecule-1 in human lung epithelial cells. Immunology. 2007 May;121(1):71-81. doi: 10.1111/j.1365-2567.2006.02539.x.
23 MiR-146a affects the alteration in myeloid differentiation induced by hydroquinone in human CD34(+) hematopoietic progenitor cells and HL-60 cells. Toxicol Res (Camb). 2016 Feb 16;5(3):848-858. doi: 10.1039/c5tx00419e. eCollection 2016 May 1.
24 DNA array analysis of the effects of aspirin on colon cancer cells: involvement of Rac1. Carcinogenesis. 2004 Jul;25(7):1293-8.
25 Pharmacological targeting of NF-kappaB potentiates the effect of the topoisomerase inhibitor CPT-11 on colon cancer cells. Br J Cancer. 2008 Jan 29;98(2):335-44. doi: 10.1038/sj.bjc.6604082. Epub 2008 Jan 8.
26 Nicotine prevents the apoptosis induced by menadione in human lung cancer cells. Biochem Biophys Res Commun. 2006 Apr 14;342(3):928-34. doi: 10.1016/j.bbrc.2006.02.047.
27 Gene markers in dendritic cells unravel pieces of the skin sensitization puzzle. Toxicol Lett. 2010 Jul 1;196(2):95-103. doi: 10.1016/j.toxlet.2010.04.003. Epub 2010 Apr 10.
28 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
29 Suppression of RAGE as a basis of simvastatin-dependent plaque stabilization in type 2 diabetes. Arterioscler Thromb Vasc Biol. 2006 Dec;26(12):2716-23.
30 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
31 AMPK-dependent signaling modulates the suppression of invasion and migration by fenofibrate in CAL 27 oral cancer cells through NF-B pathway. Environ Toxicol. 2016 Jul;31(7):866-76. doi: 10.1002/tox.22097. Epub 2014 Dec 24.
32 The thioredoxin system mediates redox-induced cell death in human colon cancer cells: implications for the mechanism of action of anticancer agents. Cancer Res. 2008 Oct 15;68(20):8269-77. doi: 10.1158/0008-5472.CAN-08-2010.
33 Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
34 Methamphetamine induces AP-1 and NF-kappaB binding and transactivation in human brain endothelial cells. J Neurosci Res. 2001 Nov 15;66(4):583-91. doi: 10.1002/jnr.1248.
35 Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
36 Establishment of a 13 genes-based molecular prediction score model to discriminate the neurotoxic potential of food relevant-chemicals. Toxicol Lett. 2022 Feb 1;355:1-18. doi: 10.1016/j.toxlet.2021.10.013. Epub 2021 Nov 5.
37 Identification of genes linked to gefitinib treatment in prostate cancer cell lines with or without resistance to androgen: a clue to application of gefitinib to hormone-resistant prostate cancer. Oncol Rep. 2006 Jun;15(6):1453-60.
38 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
39 Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
40 Efficient intervention of growth and infiltration of primary adult T-cell leukemia cells by an HIV protease inhibitor, ritonavir. Blood. 2006 Jan 15;107(2):716-24. doi: 10.1182/blood-2005-02-0735. Epub 2005 Sep 20.
41 Response rate of fibrosarcoma cells to cytotoxic drugs on the expression level correlates to the therapeutic response rate of fibrosarcomas and is mediated by regulation of apoptotic pathways. BMC Cancer. 2005 Jul 7;5:74. doi: 10.1186/1471-2407-5-74.
42 Asbestos induces nitric oxide synthesis in mesothelioma cells via Rho signaling inhibition. Am J Respir Cell Mol Biol. 2007 Jun;36(6):746-56. doi: 10.1165/rcmb.2006-0011OC. Epub 2007 Feb 22.
43 Cytotoxic effects of mithramycin DIG-MSK can depend on the rise of autophagy. Toxicol In Vitro. 2015 Oct;29(7):1537-44. doi: 10.1016/j.tiv.2015.06.008. Epub 2015 Jun 13.
44 The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
45 Interactions between bortezomib and romidepsin and belinostat in chronic lymphocytic leukemia cells. Clin Cancer Res. 2008 Jan 15;14(2):549-58. doi: 10.1158/1078-0432.CCR-07-1934.
46 Histamine-induced production of interleukin-6 and interleukin-8 by human coronary artery endothelial cells is enhanced by endotoxin and tumor necrosis factor-alpha. Microvasc Res. 2001 May;61(3):253-62. doi: 10.1006/mvre.2001.2304.
47 Sulfasalazine down-regulates the expression of the angiogenic factors platelet-derived endothelial cell growth factor/thymidine phosphorylase and interleukin-8 in human monocytic-macrophage THP1 and U937 cells. Mol Pharmacol. 2004 Oct;66(4):1054-60.
48 Direct transcriptomic comparison of xenobiotic metabolism and toxicity pathway induction of airway epithelium models at an air-liquid interface generated from induced pluripotent stem cells and primary bronchial epithelial cells. Cell Biol Toxicol. 2023 Feb;39(1):1-18. doi: 10.1007/s10565-022-09726-0. Epub 2022 May 31.
49 Targeting activation of specific NF-B subunits prevents stress-dependent atherothrombotic gene expression. Mol Med. 2012 Dec 20;18(1):1375-86. doi: 10.2119/molmed.2012.00282.
50 Activation of beta(2)-adrenoceptor prevents shiga toxin 2-induced TNF-alpha gene transcription. J Am Soc Nephrol. 2001 Nov;12(11):2288-2299. doi: 10.1681/ASN.V12112288.
51 Diazoxide-mediated preconditioning against apoptosis involves activation of cAMP-response element-binding protein (CREB) and NFkappaB. J Biol Chem. 2004 Nov 5;279(45):46748-54. doi: 10.1074/jbc.M406217200. Epub 2004 Aug 23.
52 Dienogest inhibits aromatase and cyclooxygenase-2 expression and prostaglandin E?production in human endometriotic stromal cells in spheroid culture. Fertil Steril. 2012 Feb;97(2):477-82.
53 Synthesis and biological analysis of new curcumin analogues bearing an enhanced potential for the medicinal treatment of cancer. Mol Cancer Ther. 2006 Oct;5(10):2563-71. doi: 10.1158/1535-7163.MCT-06-0174.
54 Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
55 Indole-3-carbinol suppresses NF-kappaB and IkappaBalpha kinase activation, causing inhibition of expression of NF-kappaB-regulated antiapoptotic and metastatic gene products and enhancement of apoptosis in myeloid and leukemia cells. Blood. 2005 Jul 15;106(2):641-9. doi: 10.1182/blood-2004-12-4589. Epub 2005 Apr 5.
56 The Nedd8-activating enzyme inhibitor MLN4924 thwarts microenvironment-driven NF-B activation and induces apoptosis in chronic lymphocytic leukemia B cells. Clin Cancer Res. 2014 Mar 15;20(6):1576-89. doi: 10.1158/1078-0432.CCR-13-0987.
57 Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
58 PCI-24781 induces caspase and reactive oxygen species-dependent apoptosis through NF-kappaB mechanisms and is synergistic with bortezomib in lymphoma cells. Clin Cancer Res. 2009 May 15;15(10):3354-65. doi: 10.1158/1078-0432.CCR-08-2365. Epub 2009 May 5.
59 Alpha-tocopherol modulates human umbilical vein endothelial cell expression of Cu/Zn superoxide dismutase and catalase and lipid peroxidation. Nutr Res. 2008 Oct;28(10):671-80.
60 Roles of ERK and p38 mitogen-activated protein kinases in phorbol ester-induced NF-kappaB activation and COX-2 expression in human breast epithelial cells. Chem Biol Interact. 2008 Jan 30;171(2):133-41. doi: 10.1016/j.cbi.2007.07.008. Epub 2007 Jul 26.
61 Combination of xanthohumol and phenethyl isothiocyanate inhibits NF-B and activates Nrf2 in pancreatic cancer cells. Toxicol In Vitro. 2020 Jun;65:104799. doi: 10.1016/j.tiv.2020.104799. Epub 2020 Feb 15.
62 Baicalein inhibits the migration and invasive properties of human hepatoma cells. Toxicol Appl Pharmacol. 2011 Sep 15;255(3):316-26. doi: 10.1016/j.taap.2011.07.008. Epub 2011 Jul 23.
63 Piperine is a potent inhibitor of nuclear factor-kappaB (NF-kappaB), c-Fos, CREB, ATF-2 and proinflammatory cytokine gene expression in B16F-10 melanoma cells. Int Immunopharmacol. 2004 Dec 20;4(14):1795-803. doi: 10.1016/j.intimp.2004.08.005.
64 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
65 Use of human neuroblastoma SH-SY5Y cells to evaluate glyphosate-induced effects on oxidative stress, neuronal development and cell death signaling pathways. Environ Int. 2020 Feb;135:105414. doi: 10.1016/j.envint.2019.105414. Epub 2019 Dec 23.
66 Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
67 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
68 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
69 Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. Epub 2022 Jan 24.
70 Constitutive activation of NF-kappaB in Ki-ras-transformed prostate epithelial cells. Oncogene. 2002 Jul 4;21(29):4490-7. doi: 10.1038/sj.onc.1205547.
71 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
72 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
73 Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
74 Coumestrol, bisphenol-A, DDT, and TCDD modulation of interleukin-2 expression in activated CD+4 Jurkat T cells. Int J Environ Res Public Health. 2004 Mar;1(1):3-11. doi: 10.3390/ijerph2004010003.
75 Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
76 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
77 Polyphenolics from a?( Euterpe oleracea Mart.) and red muscadine grape (Vitis rotundifolia ) protect human umbilical vascular Endothelial cells (HUVEC) from glucose- and lipopolysaccharide (LPS)-induced inflammation and target microRNA-126. J Agric Food Chem. 2011 Jul 27;59(14):7999-8012.
78 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
79 MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
80 Inflammatory effects of acrolein, crotonaldehyde and hexanal vapors on human primary bronchial epithelial cells cultured at air-liquid interface. Toxicol In Vitro. 2018 Feb;46:219-228. doi: 10.1016/j.tiv.2017.09.016. Epub 2017 Sep 22.
81 Inhibition of NFkappaB activation and IL-8 expression in human bronchial epithelial cells by acrolein. Antioxid Redox Signal. 2005 Jan-Feb;7(1-2):25-31. doi: 10.1089/ars.2005.7.25.
82 The synthetic bile acid-phospholipid conjugate ursodeoxycholyl lysophosphatidylethanolamide suppresses TNF-induced liver injury. J Hepatol. 2011 Apr;54(4):674-84. doi: 10.1016/j.jhep.2010.07.028. Epub 2010 Sep 27.
83 Cordycepin Enhances SIRT1 Expression and Maintains Stemness of Human Mesenchymal Stem Cells. In Vivo. 2023 Mar-Apr;37(2):596-610. doi: 10.21873/invivo.13118.
84 Nicotinic receptors mediate tumorigenic action of tobacco-derived nitrosamines on immortalized oral epithelial cells. Cancer Biol Ther. 2006 May;5(5):511-7. doi: 10.4161/cbt.5.5.2601. Epub 2006 May 13.
85 Linalool preferentially induces robust apoptosis of a variety of leukemia cells via upregulating p53 and cyclin-dependent kinase inhibitors. Toxicology. 2010 Jan 31;268(1-2):19-24. doi: 10.1016/j.tox.2009.11.013. Epub 2009 Nov 14.
86 Apigenin potentiates the growth inhibitory effects by IKK--mediated NF-B activation in pancreatic cancer cells. Toxicol Lett. 2014 Jan 3;224(1):157-64. doi: 10.1016/j.toxlet.2013.10.007. Epub 2013 Oct 19.
87 Inhibition of nuclear translocation of nuclear factor-kappaB despite lack of functional IkappaBalpha protein overcomes multiple defects in apoptosis signaling in human B-cell malignancies. Clin Cancer Res. 2005 Nov 15;11(22):8186-94. doi: 10.1158/1078-0432.CCR-05-0224.
88 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
89 Development and molecular characterization of HCT-116 cell lines resistant to the tumor promoter and multiple stress-inducer, deoxycholate. Carcinogenesis. 2002 Dec;23(12):2063-80. doi: 10.1093/carcin/23.12.2063.