Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOZSV6O)

DOT Name Golgi membrane protein 1 (GOLM1)
Synonyms Golgi membrane protein GP73; Golgi phosphoprotein 2
Gene Name GOLM1
Related Disease
Lung adenocarcinoma ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alcoholic liver diseases ( )
Barrett esophagus ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma of esophagus ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cervical cancer ( )
Cervical carcinoma ( )
Cholangiocarcinoma ( )
Cholestasis ( )
Chronic hepatitis B virus infection ( )
Colorectal carcinoma ( )
Esophageal adenocarcinoma ( )
Esophageal cancer ( )
Esophageal squamous cell carcinoma ( )
Fatty liver disease ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Liver cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lung squamous cell carcinoma ( )
Osteoporosis ( )
Pancreatic cancer ( )
Prostate neoplasm ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Metastatic malignant neoplasm ( )
Cutaneous melanoma ( )
High blood pressure ( )
Matthew-Wood syndrome ( )
Melanoma ( )
Non-small-cell lung cancer ( )
Pancreatic ductal carcinoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Squamous cell carcinoma ( )
UniProt ID
GOLM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAER
GAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVL
QDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKK
GNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSS
EVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTP
QVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAES
ETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Function Unknown. Cellular response protein to viral infection.
Tissue Specificity
Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), it is strongly expressed in hepatocytes-derived syncytial giant cells. Constitutively expressed by biliary epithelial cells but not by hepatocytes.
Reactome Pathway
Post-translational protein phosphorylation (R-HSA-8957275 )
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung adenocarcinoma DISD51WR Definitive Biomarker [1]
Adult glioblastoma DISVP4LU Strong Biomarker [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [3]
Alcoholic liver diseases DISXEPHQ Strong Altered Expression [4]
Barrett esophagus DIS416Y7 Strong Biomarker [5]
Bladder cancer DISUHNM0 Strong Biomarker [6]
Breast cancer DIS7DPX1 Strong Altered Expression [7]
Breast carcinoma DIS2UE88 Strong Altered Expression [7]
Carcinoma of esophagus DISS6G4D Strong Biomarker [8]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Biomarker [9]
Cervical cancer DISFSHPF Strong Biomarker [10]
Cervical carcinoma DIST4S00 Strong Biomarker [10]
Cholangiocarcinoma DIS71F6X Strong Biomarker [11]
Cholestasis DISDJJWE Strong Biomarker [12]
Chronic hepatitis B virus infection DISHL4NT Strong Biomarker [13]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [14]
Esophageal adenocarcinoma DISODWFP Strong Biomarker [5]
Esophageal cancer DISGB2VN Strong Biomarker [5]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [8]
Fatty liver disease DIS485QZ Strong Biomarker [15]
Gastric cancer DISXGOUK Strong Biomarker [16]
Glioblastoma multiforme DISK8246 Strong Altered Expression [2]
Glioma DIS5RPEH Strong Biomarker [17]
Hepatitis DISXXX35 Strong Biomarker [13]
Hepatitis A virus infection DISUMFQV Strong Biomarker [9]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [18]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [19]
Liver cancer DISDE4BI Strong Biomarker [9]
Lung cancer DISCM4YA Strong Biomarker [14]
Lung carcinoma DISTR26C Strong Biomarker [14]
Lung squamous cell carcinoma DISXPIBD Strong Biomarker [1]
Osteoporosis DISF2JE0 Strong Biomarker [20]
Pancreatic cancer DISJC981 Strong Biomarker [21]
Prostate neoplasm DISHDKGQ Strong Altered Expression [22]
Stomach cancer DISKIJSX Strong Biomarker [23]
Urinary bladder cancer DISDV4T7 Strong Biomarker [6]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [6]
Metastatic malignant neoplasm DIS86UK6 moderate Biomarker [23]
Cutaneous melanoma DIS3MMH9 Limited Genetic Variation [24]
High blood pressure DISY2OHH Limited Biomarker [25]
Matthew-Wood syndrome DISA7HR7 Limited Altered Expression [21]
Melanoma DIS1RRCY Limited Biomarker [24]
Non-small-cell lung cancer DIS5Y6R9 Limited Altered Expression [26]
Pancreatic ductal carcinoma DIS26F9Q Limited Altered Expression [21]
Prostate cancer DISF190Y Limited Altered Expression [27]
Prostate carcinoma DISMJPLE Limited Altered Expression [27]
Squamous cell carcinoma DISQVIFL Limited Altered Expression [28]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Golgi membrane protein 1 (GOLM1). [29]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Golgi membrane protein 1 (GOLM1). [30]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Golgi membrane protein 1 (GOLM1). [31]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Golgi membrane protein 1 (GOLM1). [32]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Golgi membrane protein 1 (GOLM1). [33]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Golgi membrane protein 1 (GOLM1). [34]
Marinol DM70IK5 Approved Marinol increases the expression of Golgi membrane protein 1 (GOLM1). [35]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Golgi membrane protein 1 (GOLM1). [36]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Golgi membrane protein 1 (GOLM1). [37]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Golgi membrane protein 1 (GOLM1). [39]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Golgi membrane protein 1 (GOLM1). [40]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Golgi membrane protein 1 (GOLM1). [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Golgi membrane protein 1 (GOLM1). [38]
------------------------------------------------------------------------------------

References

1 Increased GOLM1 Expression Independently Predicts Unfavorable Overall Survival and Recurrence-Free Survival in Lung Adenocarcinoma.Cancer Control. 2018 Jan-Mar;25(1):1073274818778001. doi: 10.1177/1073274818778001.
2 GOLM1 silencing inhibits the proliferation and motility of human glioblastoma cells via the Wnt/-catenin signaling pathway.Brain Res. 2019 Aug 15;1717:117-126. doi: 10.1016/j.brainres.2019.03.035. Epub 2019 Mar 29.
3 c-Myc transactivates GP73 and promotes metastasis of hepatocellular carcinoma cells through GP73-mediated MMP-7 trafficking in a mildly hypoxic microenvironment.Oncogenesis. 2019 Oct 7;8(10):58. doi: 10.1038/s41389-019-0166-7.
4 CXCL10 decreases GP73 expression in hepatoma cells at the early stage of hepatitis C virus (HCV) infection.Int J Mol Sci. 2013 Dec 13;14(12):24230-41. doi: 10.3390/ijms141224230.
5 Golgi phosphoprotein 2 (GOLPH2) is a novel bile acid-responsive modulator of oesophageal cell migration and invasion.Br J Cancer. 2015 Nov 3;113(9):1332-42. doi: 10.1038/bjc.2015.350. Epub 2015 Oct 13.
6 GP73 promotes invasion and metastasis of bladder cancer by regulating the epithelial-mesenchymal transition through the TGF-1/Smad2 signalling pathway.J Cell Mol Med. 2018 Mar;22(3):1650-1665. doi: 10.1111/jcmm.13442. Epub 2018 Jan 19.
7 Golgi Membrane Protein 1 (GOLM1) Promotes Growth and Metastasis of Breast Cancer Cells via Regulating Matrix Metalloproteinase-13 (MMP13).Med Sci Monit. 2019 Jan 29;25:847-855. doi: 10.12659/MSM.911667.
8 Evaluation of Salivary Exosomal Chimeric GOLM1-NAA35 RNA as a Potential Biomarker in Esophageal Carcinoma.Clin Cancer Res. 2019 May 15;25(10):3035-3045. doi: 10.1158/1078-0432.CCR-18-3169. Epub 2019 Feb 11.
9 Golgi protein 73 and its diagnostic value in liver diseases.Cell Prolif. 2019 Mar;52(2):e12538. doi: 10.1111/cpr.12538. Epub 2018 Oct 19.
10 MicroRNA-143 regulates cell migration and invasion by targeting GOLM1 in cervical cancer.Oncol Lett. 2018 Nov;16(5):6393-6400. doi: 10.3892/ol.2018.9441. Epub 2018 Sep 17.
11 Differential membrane proteomics using 18O-labeling to identify biomarkers for cholangiocarcinoma.J Proteome Res. 2008 Nov;7(11):4670-7. doi: 10.1021/pr800215n. Epub 2008 Oct 8.
12 The Clinical Significance of GP73 in Immunologically Mediated Chronic Liver Diseases: Experimental Data and Literature Review.Clin Rev Allergy Immunol. 2018 Apr;54(2):282-294. doi: 10.1007/s12016-017-8655-y.
13 Serum GP73 combined AST and GGT reflects moderate to severe liver inflammation in chronic hepatitis B.Clin Chim Acta. 2019 Jun;493:92-97. doi: 10.1016/j.cca.2019.02.019. Epub 2019 Feb 20.
14 Therapeutic Targeting of Golgi Phosphoprotein 2 (GOLPH2) with Armed Antibodies: A Preclinical Study of Anti-GOLPH2 Antibody Drug Conjugates in Lung and Colorectal Cancer Models of Patient Derived Xenografts (PDX).Target Oncol. 2019 Oct;14(5):577-590. doi: 10.1007/s11523-019-00667-z.
15 GP73 regulates Hepatic Steatosis by enhancing SCAP-SREBPs interaction.Sci Rep. 2017 Nov 2;7(1):14932. doi: 10.1038/s41598-017-06500-9.
16 Expression of GOLPH2 is associated with the progression of and poor prognosis in gastric cancer.Oncol Rep. 2014 Nov;32(5):2077-85. doi: 10.3892/or.2014.3404. Epub 2014 Aug 14.
17 PDGFA/PDGFR-regulated GOLM1 promotes human glioma progression through activation of AKT.J Exp Clin Cancer Res. 2017 Dec 28;36(1):193. doi: 10.1186/s13046-017-0665-3.
18 Exploring the Diagnostic Potential of Serum Golgi Protein 73 for Hepatic Necroinflammation and Fibrosis in Chronic HCV Infection with Different Stages of Liver Injuries.Dis Markers. 2019 Sep 17;2019:3862024. doi: 10.1155/2019/3862024. eCollection 2019.
19 A novel oncolytic adenovirus inhibits hepatocellular carcinoma growth.J Zhejiang Univ Sci B. 2019 Dec.;20(12):1003-1013. doi: 10.1631/jzus.B1900089.
20 GOLM1 Stimulation of Glutamine Metabolism Promotes Osteoporosis via Inhibiting Osteogenic Differentiation of BMSCs.Cell Physiol Biochem. 2018;50(5):1916-1928. doi: 10.1159/000494872. Epub 2018 Nov 5.
21 GOLPH2, a gene downstream of ras signaling, promotes the progression of pancreatic ductal adenocarcinoma.Mol Med Rep. 2018 Mar;17(3):4187-4194. doi: 10.3892/mmr.2018.8430. Epub 2018 Jan 15.
22 GOLPH2 protein expression as a novel tissue biomarker for prostate cancer: implications for tissue-based diagnostics.Br J Cancer. 2008 Sep 16;99(6):939-48. doi: 10.1038/sj.bjc.6604614.
23 Identification of GOLM1 as a positively regulator of tumor metastasis by regulating MMP13 in gastric carcinoma.Cancer Biomark. 2019;26(4):421-430. doi: 10.3233/CBM-190301.
24 A Nonsynonymous Variant in the GOLM1 Gene in Cutaneous Malignant Melanoma.J Natl Cancer Inst. 2018 Dec 1;110(12):1380-1385. doi: 10.1093/jnci/djy058.
25 Clinicopathological significance of miR-27b targeting Golgi protein 73 in patients with hepatocellular carcinoma.Anticancer Drugs. 2019 Feb;30(2):186-194. doi: 10.1097/CAD.0000000000000711.
26 Overexpression of golgi membrane protein 1 promotes non-small-cell carcinoma aggressiveness by regulating the matrix metallopeptidase 13.Am J Cancer Res. 2018 Mar 1;8(3):551-565. eCollection 2018.
27 Identification of potential diagnostic and prognostic biomarkers for prostate cancer.Oncol Lett. 2019 Oct;18(4):4237-4245. doi: 10.3892/ol.2019.10765. Epub 2019 Aug 16.
28 Overexpression of Golgi Phosphoprotein 2 Is Associated With Poor Prognosis in Oral Squamous Cell Carcinoma.Am J Clin Pathol. 2018 May 31;150(1):74-83. doi: 10.1093/ajcp/aqy029.
29 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
30 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
31 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
32 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
33 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
34 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
35 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
36 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
37 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
38 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
39 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
40 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
41 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.