Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQZMP86)

• DOT Name: Laminin subunit alpha-1 (LAMA1)
• Synonyms: Laminin A chain; Laminin-1 subunit alpha; Laminin-3 subunit alpha; S-laminin subunit alpha; S-LAM alpha
• Gene Name: LAMA1
• Related Disease:
  Ataxia - intellectual disability - oculomotor apraxia - cerebellar cysts syndrome
  Autism
  Lung adenocarcinoma
  Acute leukaemia
  Adenoma
  Advanced cancer
  Alzheimer disease
  Anxiety
  Asthma
  Bladder cancer
  Chromosomal disorder
  Chronic obstructive pulmonary disease
  Colorectal carcinoma
  Esophageal squamous cell carcinoma
  Familial dilated cardiomyopathy
  Fatty liver disease
  Hyperlipidemia
  Keloid
  Keratosis pilaris
  Male infertility
  Mixed anxiety and depressive disorder
  Movement disorder
  Muscular dystrophy
  Myopathy
  Myopia
  Neoplasm
  Non-alcoholic fatty liver disease
  Non-alcoholic steatohepatitis
  Peripheral neuropathy
  Pneumonia
  Pneumonitis
  Pulmonary fibrosis
  Schizophrenia
  Systemic lupus erythematosus
  X-linked reticulate pigmentary disorder
  Fetal growth restriction
  Intellectual disability
  Prune belly syndrome
  Colorectal neoplasm
  Anxiety disorder
  Bone osteosarcoma
  Non-insulin dependent diabetes
  Osteosarcoma
• UniProt ID: LAMA1_HUMAN
• Pfam ID: PF00052 ; PF00053 ; PF00054 ; PF06008 ; PF06009 ; PF00055
• Sequence:
  MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
  VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
  YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
  ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
  LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
  CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
  CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
  GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
  ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
  SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
  DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
  TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
  ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP
  SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT
  VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
  ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS
  DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
  QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG
  YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR
  ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
  FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI
  KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
  LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
  HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG
  KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ
  TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC
  VGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE
  GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT
  LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL
  EELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
  EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS
  QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA
  RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ
  ENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS
  ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS
  EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS
  STASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEM
  SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK
  SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG
  LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
  LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN
  LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS
  GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSD
  GQAHSISLVRNRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMR
  RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
  CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ
  ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGRESPM
  VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF
  TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI
  GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA
  ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAF
  ELHGVFLHSCPGTES
• Function: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Cytoskeleton in muscle cells (hsa04820)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Human papillomavirus infection (hsa05165)
  Pathways in cancer (hsa05200)
  Small cell lung cancer (hsa05222)
  Hypertrophic cardiomyopathy (hsa05410)
  Arrhythmogenic right ventricular cardiomyopathy (hsa05412)
  Dilated cardiomyopathy (hsa05414)
  Viral myocarditis (hsa05416)
• Reactome Pathway:
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  L1CAM interactions (R-HSA-373760)
  MET activates PTK2 signaling (R-HSA-8874081)
  Laminin interactions (R-HSA-3000157)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ataxia - intellectual disability - oculomotor apraxia - cerebellar cysts syndrome	DISKGVR0	Definitive	Autosomal recessive	[1]
Autism	DISV4V1Z	Definitive	Genetic Variation	[2]
Lung adenocarcinoma	DISD51WR	Definitive	Altered Expression	[3]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[4]
Adenoma	DIS78ZEV	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[6]
Anxiety	DISIJDBA	Strong	Genetic Variation	[7]
Asthma	DISW9QNS	Strong	Biomarker	[8]
Bladder cancer	DISUHNM0	Strong	Biomarker	[9]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[10]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[13]
Familial dilated cardiomyopathy	DISBHDU9	Strong	Biomarker	[14]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[15]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[16]
Keloid	DISV09JY	Strong	Biomarker	[17]
Keratosis pilaris	DISKOBPU	Strong	Biomarker	[18]
Male infertility	DISY3YZZ	Strong	Biomarker	[19]
Mixed anxiety and depressive disorder	DISV809X	Strong	Biomarker	[16]
Movement disorder	DISOJJ2D	Strong	CausalMutation	[7]
Muscular dystrophy	DISJD6P7	Strong	Biomarker	[20]
Myopathy	DISOWG27	Strong	Altered Expression	[21]
Myopia	DISK5S60	Strong	Genetic Variation	[7]
Neoplasm	DISZKGEW	Strong	Biomarker	[10]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[15]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[15]
Peripheral neuropathy	DIS7KN5G	Strong	Biomarker	[20]
Pneumonia	DIS8EF3M	Strong	Genetic Variation	[22]
Pneumonitis	DIS88E0K	Strong	Genetic Variation	[22]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[23]
Schizophrenia	DISSRV2N	Strong	Biomarker	[24]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[25]
X-linked reticulate pigmentary disorder	DIS0RB5A	Strong	Biomarker	[26]
Fetal growth restriction	DIS5WEJ5	moderate	Biomarker	[27]
Intellectual disability	DISMBNXP	moderate	Biomarker	[18]
Prune belly syndrome	DISBIBMN	moderate	Genetic Variation	[28]
Colorectal neoplasm	DISR1UCN	Disputed	Biomarker	[29]
Anxiety disorder	DISBI2BT	Limited	Genetic Variation	[7]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[30]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[31]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[30]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Aspirin	DM672AH	Approved	Laminin subunit alpha-1 (LAMA1) increases the Adverse reaction ADR of Aspirin.	[49]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Laminin subunit alpha-1 (LAMA1).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Laminin subunit alpha-1 (LAMA1).	[43]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Laminin subunit alpha-1 (LAMA1).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Laminin subunit alpha-1 (LAMA1).	[34]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Laminin subunit alpha-1 (LAMA1).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Laminin subunit alpha-1 (LAMA1).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Laminin subunit alpha-1 (LAMA1).	[37]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Laminin subunit alpha-1 (LAMA1).	[38]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Laminin subunit alpha-1 (LAMA1).	[39]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Laminin subunit alpha-1 (LAMA1).	[40]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Laminin subunit alpha-1 (LAMA1).	[41]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Laminin subunit alpha-1 (LAMA1).	[42]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Laminin subunit alpha-1 (LAMA1).	[44]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Laminin subunit alpha-1 (LAMA1).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Laminin subunit alpha-1 (LAMA1).	[46]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Laminin subunit alpha-1 (LAMA1).	[47]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Laminin subunit alpha-1 (LAMA1).	[48]

References

• [1] Deep sequencing reveals 50 novel genes for recessive cognitive disorders. Nature. 2011 Sep 21;478(7367):57-63. doi: 10.1038/nature10423.
• [2] Individual common variants exert weak effects on the risk for autism spectrum disorders.Hum Mol Genet. 2012 Nov 1;21(21):4781-92. doi: 10.1093/hmg/dds301. Epub 2012 Jul 26.
• [3] Selective assembly of laminin variants by human carcinoma cells.Lab Invest. 1994 Nov;71(5):719-30.
• [4] Light microscopic detection of BCR-ABL transcripts after in-cell RT-PCR: fusion gene expression might correlate with clinical evolution of chronic myeloid leukemia.Leuk Lymphoma. 2000 Jan;36(3-4):383-96. doi: 10.3109/10428190009148860.
• [5] Evolution and heterogeneity of non-hereditary colorectal cancer revealed by single-cell exome sequencing.Oncogene. 2017 May 18;36(20):2857-2867. doi: 10.1038/onc.2016.438. Epub 2016 Dec 12.
• [6] Family-based association analyses of imputed genotypes reveal genome-wide significant association of Alzheimer's disease with OSBPL6, PTPRG, and PDCL3.Mol Psychiatry. 2016 Nov;21(11):1608-1612. doi: 10.1038/mp.2015.218. Epub 2016 Feb 2.
• [7] Cystic cerebellar dysplasia and biallelic LAMA1 mutations: a lamininopathy associated with tics, obsessive compulsive traits and myopia due to cell adhesion and migration defects.J Med Genet. 2016 May;53(5):318-29. doi: 10.1136/jmedgenet-2015-103416. Epub 2016 Jan 13.
• [8] Treat to target approach for asthma.J Asthma. 2020 Jun;57(6):687-690. doi: 10.1080/02770903.2019.1591443. Epub 2019 Mar 23.
• [9] Evaluation of the cytotoxic and pro-apoptotic activities of Eu(III) complexes with appended DNA intercalators in a panel of human malignant cell lines.Med Chem. 2006 Sep;2(5):439-45. doi: 10.2174/157340606778250234.
• [10] Human chronic myeloid leukemic cell line with positive Philadelphia chromosome exhibits megakaryocytic and erythroid characteristics.Exp Hematol. 1987 Sep;15(8):822-32.
• [11] A phase III study of triple therapy with budesonide/glycopyrrolate/formoterol fumarate metered dose inhaler 320/18/9.6g and 160/18/9.6g using co-suspension delivery technology in moderate-to-very severe COPD: The ETHOS study protocol.Respir Med. 2019 Oct-Nov;158:59-66. doi: 10.1016/j.rmed.2019.08.010. Epub 2019 Aug 22.
• [12] Laminin 1 orchestrates VEGFA functions in the ecosystem of colorectal carcinoma.Biol Cell. 2018 Jun 15. doi: 10.1111/boc.201800007. Online ahead of print.
• [13] MicroRNA-202 inhibits tumor progression by targeting LAMA1 in esophageal squamous cell carcinoma.Biochem Biophys Res Commun. 2016 May 13;473(4):821-827. doi: 10.1016/j.bbrc.2016.03.130. Epub 2016 Apr 1.
• [14] Dual bronchodilation in COPD: lung function and patient-reported outcomes - a review.Int J Chron Obstruct Pulmon Dis. 2016 Dec 30;12:141-168. doi: 10.2147/COPD.S116719. eCollection 2017.
• [15] Liver transcriptional profile of atherosclerosis-related genes in human nonalcoholic fatty liver disease.Atherosclerosis. 2011 Oct;218(2):378-85. doi: 10.1016/j.atherosclerosis.2011.05.014. Epub 2011 May 18.
• [16] Adherence To Respiratory And Nonrespiratory Medication In Patients With COPD: Results Of The German COSYCONET Cohort.Patient Prefer Adherence. 2019 Oct 10;13:1711-1721. doi: 10.2147/PPA.S223438. eCollection 2019.
• [17] Characterization of In Vitro Reconstructed Human Normotrophic, Hypertrophic, and Keloid Scar Models.Tissue Eng Part C Methods. 2018 Apr;24(4):242-253. doi: 10.1089/ten.TEC.2017.0464. Epub 2018 Apr 2.
• [18] A mosaic intragenic microduplication of LAMA1 and a constitutional 18p11.32 microduplication in a patient with keratosis pilaris and intellectual disability.Am J Med Genet A. 2018 Nov;176(11):2395-2403. doi: 10.1002/ajmg.a.40478. Epub 2018 Sep 23.
• [19] Laminin {alpha}1 chain corrects male infertility caused by absence of laminin {alpha}2 chain.Am J Pathol. 2005 Sep;167(3):823-33. doi: 10.1016/s0002-9440(10)62054-8.
• [20] Laminin 1 reduces muscular dystrophy in dy(2J) mice.Matrix Biol. 2018 Sep;70:36-49. doi: 10.1016/j.matbio.2018.02.024. Epub 2018 Mar 12.
• [21] Increased Expression of Laminin Subunit Alpha 1 Chain by dCas9-VP160.Mol Ther Nucleic Acids. 2017 Mar 17;6:68-79. doi: 10.1016/j.omtn.2016.11.004. Epub 2016 Dec 10.
• [22] Comparative Effects of LAMA-LABA-ICS vs LAMA-LABA for COPD: Cohort Study in Real-World Clinical Practice.Chest. 2020 Apr;157(4):846-855. doi: 10.1016/j.chest.2019.11.007. Epub 2019 Nov 22.
• [23] Laminin 1 is a genetic modifier of TGF-1-stimulated pulmonary fibrosis.JCI Insight. 2018 Sep 20;3(18):e99574. doi: 10.1172/jci.insight.99574. eCollection 2018 Sep 20.
• [24] Increased exonic de novo mutation rate in individuals with schizophrenia. Nat Genet. 2011 Jul 10;43(9):860-3. doi: 10.1038/ng.886.
• [25] Laminin-1 (LM-111) in preeclampsia and systemic lupus erythematosus.Autoimmunity. 2013 Feb;46(1):14-20. doi: 10.3109/08916934.2012.730586. Epub 2012 Dec 3.
• [26] Effects of High Glucose on the Expression of LAMA1 and Biological Behavior of Choroid Retinal Endothelial Cells.J Diabetes Res. 2018 Jun 5;2018:7504614. doi: 10.1155/2018/7504614. eCollection 2018.
• [27] Slc20a2 deficiency results in fetal growth restriction and placental calcification associated with thickened basement membranes and novel CD13 and laminin1 expressing cells.Reprod Biol. 2016 Mar;16(1):13-26. doi: 10.1016/j.repbio.2015.12.004. Epub 2016 Jan 11.
• [28] Clinical, neuroradiological and molecular characterization of cerebellar dysplasia with cysts (Poretti-Boltshauser syndrome).Eur J Hum Genet. 2016 Aug;24(9):1262-7. doi: 10.1038/ejhg.2016.19. Epub 2016 Mar 2.
• [29] Genomic and epigenomic integration identifies a prognostic signature in colon cancer.Clin Cancer Res. 2011 Mar 15;17(6):1535-45. doi: 10.1158/1078-0432.CCR-10-2509. Epub 2011 Jan 28.
• [30] Integrated analysis of gene expression and copy number variations in MET protooncogenetransformed human primary osteoblasts.Mol Med Rep. 2018 Feb;17(2):2543-2548. doi: 10.3892/mmr.2017.8135. Epub 2017 Nov 22.
• [31] Genome-wide association analyses identify 143 risk variants and putative regulatory mechanisms for type 2 diabetes.Nat Commun. 2018 Jul 27;9(1):2941. doi: 10.1038/s41467-018-04951-w.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [34] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [35] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [36] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [37] Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
• [38] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [39] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [40] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [41] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [42] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [46] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [47] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [48] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [49] Genome-wide pharmacogenomic study of citalopram-induced side effects in STAR*D. Transl Psychiatry. 2012 Jul 3;2(7):e129. doi: 10.1038/tp.2012.57.