Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS86H50)

DOT Name Interleukin-17B (IL17B)
Synonyms IL-17B; Cytokine Zcyto7; Interleukin-20; IL-20; Neuronal interleukin-17-related factor
Gene Name IL17B
Related Disease
Non-insulin dependent diabetes ( )
Pancreatic cancer ( )
Acute myelogenous leukaemia ( )
Adenocarcinoma ( )
Adult glioblastoma ( )
Advanced cancer ( )
Arteriosclerosis ( )
Arthritis ( )
Atherosclerosis ( )
Autoimmune disease ( )
Bladder cancer ( )
Bone disease ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Chronic kidney disease ( )
Glaucoma/ocular hypertension ( )
Glioblastoma multiforme ( )
Hepatocellular carcinoma ( )
Hidradenitis suppurativa ( )
Inflammatory bowel disease ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
OPTN-related open angle glaucoma ( )
Osteoporosis ( )
Pneumonia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Pulmonary fibrosis ( )
Pulmonary tuberculosis ( )
Systemic sclerosis ( )
Tuberculosis ( )
Ulcerative colitis ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Diabetic kidney disease ( )
Gastric cancer ( )
Head-neck squamous cell carcinoma ( )
Osteoarthritis ( )
Stomach cancer ( )
Stroke ( )
Systemic lupus erythematosus ( )
Colorectal carcinoma ( )
Type-1/2 diabetes ( )
Psoriasis ( )
Skin disease ( )
UniProt ID
IL17B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF06083
Sequence
MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARME
EYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR
CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Function Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1.
Tissue Specificity Expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Less pronounced expression in prostate, colon mucosal lining, and ovary.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
IL-17 sig.ling pathway (hsa04657 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Non-insulin dependent diabetes DISK1O5Z Definitive Biomarker [1]
Pancreatic cancer DISJC981 Definitive Biomarker [2]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [3]
Adenocarcinoma DIS3IHTY Strong Biomarker [4]
Adult glioblastoma DISVP4LU Strong Altered Expression [5]
Advanced cancer DISAT1Z9 Strong Biomarker [6]
Arteriosclerosis DISK5QGC Strong Biomarker [5]
Arthritis DIST1YEL Strong Biomarker [7]
Atherosclerosis DISMN9J3 Strong Biomarker [5]
Autoimmune disease DISORMTM Strong Biomarker [8]
Bladder cancer DISUHNM0 Strong Biomarker [9]
Bone disease DISE1F82 Strong Biomarker [10]
Breast cancer DIS7DPX1 Strong Biomarker [11]
Breast carcinoma DIS2UE88 Strong Biomarker [11]
Breast neoplasm DISNGJLM Strong Biomarker [12]
Chronic kidney disease DISW82R7 Strong Biomarker [13]
Glaucoma/ocular hypertension DISLBXBY Strong Altered Expression [14]
Glioblastoma multiforme DISK8246 Strong Altered Expression [5]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [15]
Hidradenitis suppurativa DIS3ZNAK Strong Biomarker [16]
Inflammatory bowel disease DISGN23E Strong Biomarker [17]
Lung adenocarcinoma DISD51WR Strong Altered Expression [18]
Lung cancer DISCM4YA Strong Biomarker [18]
Lung carcinoma DISTR26C Strong Biomarker [18]
Neoplasm DISZKGEW Strong Biomarker [19]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [20]
OPTN-related open angle glaucoma DISDR98A Strong Genetic Variation [21]
Osteoporosis DISF2JE0 Strong Biomarker [10]
Pneumonia DIS8EF3M Strong Biomarker [22]
Prostate cancer DISF190Y Strong Biomarker [23]
Prostate carcinoma DISMJPLE Strong Biomarker [23]
Pulmonary fibrosis DISQKVLA Strong Biomarker [24]
Pulmonary tuberculosis DIS6FLUM Strong Biomarker [25]
Systemic sclerosis DISF44L6 Strong Biomarker [26]
Tuberculosis DIS2YIMD Strong Biomarker [25]
Ulcerative colitis DIS8K27O Strong Genetic Variation [27]
Urinary bladder cancer DISDV4T7 Strong Biomarker [9]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [9]
Diabetic kidney disease DISJMWEY moderate Biomarker [13]
Gastric cancer DISXGOUK moderate Biomarker [28]
Head-neck squamous cell carcinoma DISF7P24 moderate Biomarker [29]
Osteoarthritis DIS05URM moderate Altered Expression [30]
Stomach cancer DISKIJSX moderate Biomarker [28]
Stroke DISX6UHX moderate Biomarker [31]
Systemic lupus erythematosus DISI1SZ7 moderate Biomarker [32]
Colorectal carcinoma DIS5PYL0 Disputed Genetic Variation [33]
Type-1/2 diabetes DISIUHAP Disputed Altered Expression [34]
Psoriasis DIS59VMN Limited Biomarker [10]
Skin disease DISDW8R6 Limited Biomarker [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Interleukin-17B (IL17B). [36]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Interleukin-17B (IL17B). [38]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Interleukin-17B (IL17B). [40]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the methylation of Interleukin-17B (IL17B). [37]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Interleukin-17B (IL17B). [39]
------------------------------------------------------------------------------------

References

1 IL-20 contributes to low grade inflammation and weight gain in the Psammomys obesus.Int Immunopharmacol. 2017 Apr;45:53-67. doi: 10.1016/j.intimp.2017.01.031. Epub 2017 Feb 7.
2 A novel plectin/integrin-targeted bispecific molecular probe for magnetic resonance/near-infrared imaging of pancreatic cancer.Biomaterials. 2018 Nov;183:173-184. doi: 10.1016/j.biomaterials.2018.08.048. Epub 2018 Aug 26.
3 Leukemic IL-17RB signaling regulates leukemic survival and chemoresistance.FASEB J. 2019 Aug;33(8):9565-9576. doi: 10.1096/fj.201900099R. Epub 2019 May 28.
4 Use of indocyanine green (ICG) augmented near-infrared fluorescence imaging in robotic radical resection of gallbladder adenocarcinomas.Surg Endosc. 2020 Jun;34(6):2490-2494. doi: 10.1007/s00464-019-07053-w. Epub 2019 Aug 6.
5 IL-20 is regulated by hypoxia-inducible factor and up-regulated after experimental ischemic stroke.J Immunol. 2009 Apr 15;182(8):5003-12. doi: 10.4049/jimmunol.0803653.
6 A transcriptional complex composed of ER(), GATA3, FOXA1 and ELL3 regulates IL-20 expression in breast cancer cells.Oncotarget. 2017 Jun 27;8(26):42752-42760. doi: 10.18632/oncotarget.17459.
7 A Broad Blockade of Signaling from the IL-20 Family of Cytokines Potently Attenuates Collagen-Induced Arthritis.J Immunol. 2016 Oct 15;197(8):3029-3037. doi: 10.4049/jimmunol.1600399. Epub 2016 Sep 12.
8 The IL-17 Family of Cytokines in Health and Disease.Immunity. 2019 Apr 16;50(4):892-906. doi: 10.1016/j.immuni.2019.03.021.
9 Identification of pro-inflammatory cytokines associated with muscle invasive bladder cancer; the roles of IL-5, IL-20, and IL-28A.PLoS One. 2012;7(9):e40267. doi: 10.1371/journal.pone.0040267. Epub 2012 Sep 4.
10 IL-20 bone diseases involvement and therapeutic target potential.J Biomed Sci. 2018 Apr 24;25(1):38. doi: 10.1186/s12929-018-0439-z.
11 Biological Properties and the Role of IL-25 in Disease Pathogenesis.J Immunol Res. 2018 Sep 23;2018:6519465. doi: 10.1155/2018/6519465. eCollection 2018.
12 The IL-17B-IL-17 receptor B pathway promotes resistance to paclitaxel in breast tumors through activation of the ERK1/2 pathway.Oncotarget. 2017 Dec 6;8(69):113360-113372. doi: 10.18632/oncotarget.23008. eCollection 2017 Dec 26.
13 The role of IL-20 in chronic kidney disease and diabetic nephropathy: Pathogenic and therapeutic implications.J Leukoc Biol. 2018 Nov;104(5):919-923. doi: 10.1002/JLB.MR1217-489R. Epub 2018 Jul 12.
14 The Role of the IL-20 Subfamily in Glaucoma.Mediators Inflamm. 2016;2016:4083735. doi: 10.1155/2016/4083735. Epub 2016 Jan 20.
15 Anti-IL-20 monoclonal antibody suppresses hepatocellular carcinoma progression.Oncol Lett. 2018 Nov;16(5):6156-6162. doi: 10.3892/ol.2018.9402. Epub 2018 Sep 5.
16 A new T helper 17 cytokine in hidradenitis suppurativa: antimicrobial and proinflammatory role of interleukin-26.Br J Dermatol. 2019 Nov;181(5):1038-1045. doi: 10.1111/bjd.17854. Epub 2019 Jun 23.
17 IL-19 Up-Regulates Mucin 5AC Production in Patients With Chronic Rhinosinusitis via STAT3 Pathway.Front Immunol. 2019 Jul 17;10:1682. doi: 10.3389/fimmu.2019.01682. eCollection 2019.
18 Comprehensive genomic and prognostic analysis of the IL?7 family genes in lung cancer.Mol Med Rep. 2019 Jun;19(6):4906-4918. doi: 10.3892/mmr.2019.10164. Epub 2019 Apr 15.
19 A multifunctional theranostic contrast agent for ultrasound/near infrared fluorescence imaging-based tumor diagnosis and ultrasound-triggered combined photothermal and gene therapy.Acta Biomater. 2019 Nov;99:373-386. doi: 10.1016/j.actbio.2019.09.015. Epub 2019 Sep 13.
20 IL-20 is epigenetically regulated in NSCLC and down regulates the expression of VEGF.Eur J Cancer. 2011 Aug;47(12):1908-18. doi: 10.1016/j.ejca.2011.04.012. Epub 2011 May 10.
21 Analysis of interleukin-20 receptor complexes in trabecular meshwork cells and effects of cytokine signaling in anterior segment perfusion culture.Mol Vis. 2019 Apr 27;25:266-282. eCollection 2019.
22 Production of Interleukin-20 cytokines limits bacterial clearance and lung inflammation during infection by Streptococcus pneumoniae.EBioMedicine. 2018 Nov;37:417-427. doi: 10.1016/j.ebiom.2018.10.031. Epub 2018 Oct 22.
23 Repurposing antitubercular agent isoniazid for treatment of prostate cancer.Biomater Sci. 2018 Dec 18;7(1):296-306. doi: 10.1039/c8bm01189c.
24 Dysregulated Lung Commensal Bacteria Drive Interleukin-17B Production to Promote Pulmonary Fibrosis through Their Outer Membrane Vesicles.Immunity. 2019 Mar 19;50(3):692-706.e7. doi: 10.1016/j.immuni.2019.02.001. Epub 2019 Feb 26.
25 Modulation of Th1/Tc1 and Th17/Tc17 responses in pulmonary tuberculosis by IL-20 subfamily of cytokines.Cytokine. 2018 Aug;108:190-196. doi: 10.1016/j.cyto.2018.04.005. Epub 2018 Apr 21.
26 Serum concentrations of IL-17A, IL-17B, IL-17E and IL-17F in patients with systemic sclerosis.Arch Med Sci. 2019 May;15(3):706-712. doi: 10.5114/aoms.2019.84738. Epub 2019 Apr 30.
27 Genetic polymorphisms of interleukin 20 (IL-20) in patients with ulcerative colitis.Immunol Lett. 2013 Jan;149(1-2):50-3. doi: 10.1016/j.imlet.2012.11.008. Epub 2012 Nov 23.
28 IL-17B activated mesenchymal stem cells enhance proliferation and migration of gastric cancer cells.Oncotarget. 2017 Mar 21;8(12):18914-18923. doi: 10.18632/oncotarget.14835.
29 Novel Peptide NIRF Optical Surgical Navigation Agents for HNSCC.Molecules. 2019 Aug 23;24(17):3070. doi: 10.3390/molecules24173070.
30 Anti-IL-20 monoclonal antibody inhibited inflammation and protected against cartilage destruction in murine models of osteoarthritis.PLoS One. 2017 Apr 20;12(4):e0175802. doi: 10.1371/journal.pone.0175802. eCollection 2017.
31 Anti-IL-20 monoclonal antibody inhibits the differentiation of osteoclasts and protects against osteoporotic bone loss.J Exp Med. 2011 Aug 29;208(9):1849-61. doi: 10.1084/jem.20102234. Epub 2011 Aug 15.
32 Interleukin-20 targets renal mesangial cells and is associated with lupus nephritis.Clin Immunol. 2008 Nov;129(2):277-85. doi: 10.1016/j.clim.2008.07.006. Epub 2008 Sep 3.
33 NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor.Cell Cycle. 2011 Oct 1;10(19):3284-99. doi: 10.4161/cc.10.19.17176. Epub 2011 Oct 1.
34 Interleukin-20 targets podocytes and is upregulated in experimental murine diabetic nephropathy.Exp Mol Med. 2017 Mar 31;49(3):e310. doi: 10.1038/emm.2016.169.
35 Signaling via the IL-20 receptor inhibits cutaneous production of IL-1 and IL-17A to promote infection with methicillin-resistant Staphylococcus aureus.Nat Immunol. 2013 Aug;14(8):804-11. doi: 10.1038/ni.2637. Epub 2013 Jun 23.
36 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
37 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
38 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
39 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
40 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.