Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSJNHTH)

• DOT Name: Myocardin (MYOCD)
• Gene Name: MYOCD
• Related Disease:
  Chronic kidney disease
  Acute megakaryoblastic leukemia
  Advanced cancer
  Alzheimer disease
  Atrial fibrillation
  Cardiac failure
  Cardiomyopathy
  Cardiovascular disease
  Congenital heart disease
  Congestive heart failure
  Diabetic kidney disease
  Dilated cardiomyopathy
  Dilated cardiomyopathy 1A
  Erectile dysfunction
  Hypertrophic cardiomyopathy
  Lateral meningocele syndrome
  Lentivirus infection
  Limb-mammary syndrome
  Liposarcoma
  Myocardial infarction
  Neoplasm
  Nephropathy
  Opioid dependence
  Renal fibrosis
  Uterine fibroids
  Varicose veins
  Vascular disease
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Familial atrial fibrillation
  High blood pressure
  Leiomyosarcoma
  Nasopharyngeal carcinoma
  Osteosarcoma
  Coronary heart disease
  Arteriosclerosis
  Atherosclerosis
  Megabladder, congenital
  Metastatic malignant neoplasm
  Smith-McCort dysplasia 1
• UniProt ID: MYCD_HUMAN
• Pfam ID: PF02755 ; PF02037
• Sequence:
  MTLLGSEHSLLIRSKFRSVLQLRLQQRRTQEQLANQGIIPPLKRPAEFHEQRKHLDSDKA
  KNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQMKLKRARLADDLNEKIALRPGPLE
  LVEKNILPVDSAVKEAIKGNQVSFSKSTDAFAFEEDSSSDGLSPDQTRSEDPQNSAGSPP
  DAKASDTPSTGSLGTNQDLASGSENDRNDSASQPSHQSDAGKQGLGPPSTPIAVHAAVKS
  KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLLQQQQLFLQLQ
  ILSQQQQQQQHRFSYLGMHQAQLKEPNEQMVRNPNSSSTPLSNTPLSPVKNSFSGQTGVS
  SFKPGPLPPNLDDLKVSELRQQLRIRGLPVSGTKTALMDRLRPFQDCSGNPVPNFGDITT
  VTFPVTPNTLPNYQSSSSTSALSNGFYHFGSTSSSPPISPASSDLSVAGSLPDTFNDASP
  SFGLHPSPVHVCTEESLMSSLNGGSVPSELDGLDSEKDKMLVEKQKVINELTWKLQQEQR
  QVEELRMQLQKQKRNNCSEKKPLPFLAASIKQEEAVSSCPFASQVPVKRQSSSSECHPPA
  CEAAQLQPLGNAHCVESSDQTNVLSSTFLSPQCSPQHSPLGAVKSPQHISLPPSPNNPHF
  LPSSSGAQGEGHRVSSPISSQVCTAQMAGLHSSDKVGPKFSIPSPTFSKSSSAISEVTQP
  PSYEDAVKQQMTRSQQMDELLDVLIESGEMPADAREDHSCLQKVPKIPRSSRSPTAVLTK
  PSASFEQASSGSQIPFDPYATDSDEHLEVLLNSQSPLGKMSDVTLLKIGSEEPHFDGIMD
  GFSGKAAEDLFNAHEILPGPLSPMQTQFSPSSVDSNGLQLSFTESPWETMEWLDLTPPNS
  TPGFSALTTSSPSIFNIDFLDVTDLNLNSSMDLHLQQW
• Function: Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis, urinary bladder development, and differentiation of the smooth muscle cell lineage (myogenesis). Positively regulates the transcription of genes involved in vascular smooth muscle contraction.
• Tissue Specificity: Expressed in the heart, aorta and bladder . Expressed in smooth muscle cell-containing tissues: stomach, small intestine, colon, lung, placenta and uterus . Very faint expression in prostate and skeletal muscle .
• Reactome Pathway: Cardiogenesis (R-HSA-9733709)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic kidney disease	DISW82R7	Definitive	Altered Expression	[1]
Acute megakaryoblastic leukemia	DIS0JX3M	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[5]
Cardiac failure	DISDC067	Strong	Altered Expression	[6]
Cardiomyopathy	DISUPZRG	Strong	Biomarker	[7]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[8]
Congenital heart disease	DISQBA23	Strong	Biomarker	[7]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[6]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[9]
Dilated cardiomyopathy	DISX608J	Strong	Altered Expression	[6]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[10]
Erectile dysfunction	DISD8MTH	Strong	Biomarker	[11]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[12]
Lateral meningocele syndrome	DISG74RP	Strong	Biomarker	[13]
Lentivirus infection	DISX17PY	Strong	Altered Expression	[14]
Limb-mammary syndrome	DIS7H4FP	Strong	Biomarker	[13]
Liposarcoma	DIS8IZVM	Strong	Altered Expression	[15]
Myocardial infarction	DIS655KI	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Nephropathy	DISXWP4P	Strong	Altered Expression	[10]
Opioid dependence	DIS6WEHK	Strong	Genetic Variation	[17]
Renal fibrosis	DISMHI3I	Strong	Altered Expression	[18]
Uterine fibroids	DISBZRMJ	Strong	Biomarker	[19]
Varicose veins	DISIMBN2	Strong	Biomarker	[20]
Vascular disease	DISVS67S	Strong	Biomarker	[21]
Bone osteosarcoma	DIST1004	moderate	Altered Expression	[22]
Breast cancer	DIS7DPX1	moderate	Biomarker	[3]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[3]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[5]
High blood pressure	DISY2OHH	moderate	Biomarker	[23]
Leiomyosarcoma	DIS6COXM	moderate	Biomarker	[16]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[24]
Osteosarcoma	DISLQ7E2	moderate	Altered Expression	[22]
Coronary heart disease	DIS5OIP1	Disputed	Biomarker	[25]
Arteriosclerosis	DISK5QGC	Limited	Altered Expression	[26]
Atherosclerosis	DISMN9J3	Limited	Altered Expression	[26]
Megabladder, congenital	DIS4Q9PL	Limited	Autosomal dominant	[7]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[27]
Smith-McCort dysplasia 1	DIS8072R	Limited	Altered Expression	[28]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Myocardin (MYOCD).	[29]
Ciclosporin	DMAZJFX	Approved	Ciclosporin affects the expression of Myocardin (MYOCD).	[30]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Myocardin (MYOCD).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Myocardin (MYOCD).	[32]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Myocardin (MYOCD).	[34]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Myocardin (MYOCD).	[35]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Myocardin (MYOCD).	[36]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Myocardin (MYOCD).	[37]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Myocardin (MYOCD).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Myocardin (MYOCD).	[41]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Myocardin (MYOCD).	[34]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Myocardin (MYOCD).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Myocardin (MYOCD).	[44]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Myocardin (MYOCD).	[45]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Myocardin (MYOCD).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Myocardin (MYOCD).	[39]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Myocardin (MYOCD).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Myocardin (MYOCD).	[42]

References

• [1] Decreased microRNA is involved in the vascular remodeling abnormalities in chronic kidney disease (CKD).PLoS One. 2013 May 22;8(5):e64558. doi: 10.1371/journal.pone.0064558. Print 2013.
• [2] MiR-93-5p inhibits the EMT of breast cancer cells via targeting MKL-1 and STAT3.Exp Cell Res. 2017 Aug 1;357(1):135-144. doi: 10.1016/j.yexcr.2017.05.007. Epub 2017 May 9.
• [3] Myocardin inhibits estrogen receptor alpha-mediated proliferation of human breast cancer MCF-7 cells via regulating MicroRNA expression.IUBMB Life. 2016 Jun;68(6):477-87. doi: 10.1002/iub.1507. Epub 2016 May 9.
• [4] Serum response factor and myocardin mediate arterial hypercontractility and cerebral blood flow dysregulation in Alzheimer's phenotype.Proc Natl Acad Sci U S A. 2007 Jan 16;104(3):823-8. doi: 10.1073/pnas.0608251104. Epub 2007 Jan 10.
• [5] Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
• [6] Myocardin mRNA is augmented in the failing myocardium: expression profiling in the porcine model and human dilated cardiomyopathy.J Mol Med (Berl). 2003 Sep;81(9):566-77. doi: 10.1007/s00109-003-0470-7. Epub 2003 Aug 13.
• [7] Loss-of-function variants in myocardin cause congenital megabladder in humans and mice. J Clin Invest. 2019 Dec 2;129(12):5374-5380. doi: 10.1172/JCI128545.
• [8] LncRNA CAIF inhibits autophagy and attenuates myocardial infarction by blocking p53-mediated myocardin transcription.Nat Commun. 2018 Jan 2;9(1):29. doi: 10.1038/s41467-017-02280-y.
• [9] High glucose downregulates myocardin expression in rat glomerular mesangial cells via the ERK signaling pathway.Oncotarget. 2017 Aug 24;8(50):87390-87400. doi: 10.18632/oncotarget.20498. eCollection 2017 Oct 20.
• [10] Myocardin ablation in a cardiac-renal rat model.Sci Rep. 2019 Apr 10;9(1):5872. doi: 10.1038/s41598-019-42009-z.
• [11] In vivo tracking on longer retention of transplanted myocardin gene-modified adipose-derived stem cells to improve erectile dysfunction in diabetic rats.Stem Cell Res Ther. 2019 Jul 16;10(1):208. doi: 10.1186/s13287-019-1325-7.
• [12] Myocardin gene regulatory variants as surrogate markers of cardiac hypertrophy - study in a genetically homogeneous population.Clin Genet. 2008 Jan;73(1):71-8. doi: 10.1111/j.1399-0004.2007.00932.x. Epub 2007 Nov 19.
• [13] Targeted exome sequencing profiles genetic alterations in leiomyosarcoma.Genes Chromosomes Cancer. 2016 Feb;55(2):124-30. doi: 10.1002/gcc.22318. Epub 2015 Nov 6.
• [14] NF-B inhibits the differentiation of hysteromyoma cells by reducing myocardin expression.Eur Rev Med Pharmacol Sci. 2018 Jul;22(13):4075-4079. doi: 10.26355/eurrev_201807_15397.
• [15] Strong smooth muscle differentiation is dependent on myocardin gene amplification in most human retroperitoneal leiomyosarcomas.Cancer Res. 2009 Mar 15;69(6):2269-78. doi: 10.1158/0008-5472.CAN-08-1443. Epub 2009 Mar 10.
• [16] Genome profiling is an efficient tool to avoid the STUMP classification of uterine smooth muscle lesions: a comprehensive array-genomic hybridization analysis of 77 tumors.Mod Pathol. 2018 May;31(5):816-828. doi: 10.1038/modpathol.2017.185. Epub 2018 Jan 12.
• [17] Response to methadone maintenance treatment is associated with the MYOCD and GRM6 genes.Mol Diagn Ther. 2010 Jun 1;14(3):171-8. doi: 10.1007/BF03256370.
• [18] Lysophosphatidic acid signaling through its receptor initiates profibrotic epithelial cell fibroblast communication mediated by epithelial cell derived connective tissue growth factor.Kidney Int. 2017 Mar;91(3):628-641. doi: 10.1016/j.kint.2016.09.030. Epub 2016 Dec 4.
• [19] ER inhibited myocardin-induced differentiation in uterine fibroids.Exp Cell Res. 2017 Jan 1;350(1):73-82. doi: 10.1016/j.yexcr.2016.11.007. Epub 2016 Nov 19.
• [20] IQGAP1 promotes the phenotypic switch of vascular smooth muscle by myocardin pathway: a potential target for varicose vein.Int J Clin Exp Pathol. 2014 Sep 15;7(10):6475-85. eCollection 2014.
• [21] Myocardin regulates vascular smooth muscle cell inflammatory activation and disease.Arterioscler Thromb Vasc Biol. 2015 Apr;35(4):817-28. doi: 10.1161/ATVBAHA.114.305218. Epub 2015 Jan 22.
• [22] MicroRNA-135b promotes proliferation, invasion and migration of osteosarcoma cells by degrading myocardin.Int J Oncol. 2014 Nov;45(5):2024-32. doi: 10.3892/ijo.2014.2641. Epub 2014 Sep 4.
• [23] Inhibition of SRF/myocardin reduces aortic stiffness by targeting vascular smooth muscle cell stiffening in hypertension.Cardiovasc Res. 2017 Feb;113(2):171-182. doi: 10.1093/cvr/cvw222. Epub 2016 Oct 23.
• [24] Frequent epigenetic inactivation of Myocardin in human nasopharyngeal carcinoma.Head Neck. 2011 Jan;33(1):54-9. doi: 10.1002/hed.21396.
• [25] Coronary Disease-Associated Gene TCF21 Inhibits Smooth Muscle Cell Differentiation by Blocking the Myocardin-Serum Response Factor Pathway.Circ Res. 2020 Feb 14;126(4):517-529. doi: 10.1161/CIRCRESAHA.119.315968. Epub 2019 Dec 9.
• [26] Liuwei Dihuang soft capsules inhibits the phenotypic conversion of VSMC to prevent the menopausal atherosclerosis by up-regulating the expression of myocardin.J Ethnopharmacol. 2020 Jan 10;246:112207. doi: 10.1016/j.jep.2019.112207. Epub 2019 Aug 30.
• [27] Tumor Progression Is Mediated by Thymosin-4 through a TGF/MRTF Signaling Axis.Mol Cancer Res. 2018 May;16(5):880-893. doi: 10.1158/1541-7786.MCR-17-0715. Epub 2018 Jan 12.
• [28] Myocardin: A novel player in atherosclerosis.Atherosclerosis. 2017 Feb;257:266-278. doi: 10.1016/j.atherosclerosis.2016.12.002. Epub 2016 Dec 1.
• [29] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [30] Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
• [31] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [32] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [33] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [34] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [35] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [36] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [37] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [38] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [39] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [40] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [41] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [42] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [43] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [44] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [45] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.