Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTH1T3D)

• DOT Name: Bcl-2-interacting killer (BIK)
• Synonyms: Apoptosis inducer NBK; BIP1; BP4
• Gene Name: BIK
• Related Disease:
  Advanced cancer
  Ataxia-telangiectasia
  B-cell lymphoma
  Bone disease
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Colorectal carcinoma
  Fanconi's anemia
  Follicular lymphoma
  Lung adenocarcinoma
  Lymphoma
  Malignant glioma
  Mantle cell lymphoma
  Myelodysplastic syndrome
  Neoplasm
  Promyelocytic leukaemia
  Prostate cancer
  Prostate carcinoma
  Small lymphocytic lymphoma
  Synovial sarcoma
  Arteriosclerosis
  Atherosclerosis
  Metabolic disorder
  Neuroblastoma
  B-cell neoplasm
  Melanoma
  Plasma cell myeloma
• UniProt ID: BIK_HUMAN
• Pfam ID: PF12201
• Sequence:
  MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR
  LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR
  FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
• Function: Accelerates programmed cell death. Association to the apoptosis repressors Bcl-X(L), BHRF1, Bcl-2 or its adenovirus homolog E1B 19k protein suppresses this death-promoting activity. Does not interact with BAX.
• KEGG Pathway: Endocrine resistance (hsa01522)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Ataxia-telangiectasia	DISP3EVR	Strong	Biomarker	[1]
B-cell lymphoma	DISIH1YQ	Strong	Genetic Variation	[2]
Bone disease	DISE1F82	Strong	Genetic Variation	[3]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[4]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[5]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[7]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[8]
Follicular lymphoma	DISVEUR6	Strong	Genetic Variation	[2]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[5]
Lymphoma	DISN6V4S	Strong	Genetic Variation	[2]
Malignant glioma	DISFXKOV	Strong	Biomarker	[9]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[10]
Myelodysplastic syndrome	DISYHNUI	Strong	Altered Expression	[11]
Neoplasm	DISZKGEW	Strong	Biomarker	[12]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[13]
Prostate cancer	DISF190Y	Strong	Altered Expression	[14]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[14]
Small lymphocytic lymphoma	DIS30POX	Strong	Genetic Variation	[2]
Synovial sarcoma	DISEZJS7	Strong	Posttranslational Modification	[15]
Arteriosclerosis	DISK5QGC	moderate	Biomarker	[16]
Atherosclerosis	DISMN9J3	moderate	Biomarker	[16]
Metabolic disorder	DIS71G5H	moderate	Biomarker	[16]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[17]
B-cell neoplasm	DISVY326	Limited	Biomarker	[18]
Melanoma	DIS1RRCY	Limited	Biomarker	[19]
Plasma cell myeloma	DIS0DFZ0	Limited	Genetic Variation	[3]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Bcl-2-interacting killer (BIK) increases the response to substance of Etoposide.	[54]
Pamidronate	DMB4AVP	Approved	Bcl-2-interacting killer (BIK) increases the response to substance of Pamidronate.	[54]
Chlorpyrifos	DMKPUI6	Investigative	Bcl-2-interacting killer (BIK) decreases the response to substance of Chlorpyrifos.	[55]

38 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Bcl-2-interacting killer (BIK).	[20]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Bcl-2-interacting killer (BIK).	[21]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Bcl-2-interacting killer (BIK).	[22]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Bcl-2-interacting killer (BIK).	[23]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Bcl-2-interacting killer (BIK).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Bcl-2-interacting killer (BIK).	[25]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Bcl-2-interacting killer (BIK).	[26]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Bcl-2-interacting killer (BIK).	[27]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Bcl-2-interacting killer (BIK).	[28]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Bcl-2-interacting killer (BIK).	[29]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Bcl-2-interacting killer (BIK).	[30]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Bcl-2-interacting killer (BIK).	[31]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Bcl-2-interacting killer (BIK).	[32]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Bcl-2-interacting killer (BIK).	[33]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Bcl-2-interacting killer (BIK).	[34]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Bcl-2-interacting killer (BIK).	[35]
Bortezomib	DMNO38U	Approved	Bortezomib increases the activity of Bcl-2-interacting killer (BIK).	[36]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Bcl-2-interacting killer (BIK).	[37]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Bcl-2-interacting killer (BIK).	[38]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Bcl-2-interacting killer (BIK).	[39]
Olanzapine	DMPFN6Y	Approved	Olanzapine increases the expression of Bcl-2-interacting killer (BIK).	[37]
Ximelegatran	DMU8ANS	Approved	Ximelegatran decreases the expression of Bcl-2-interacting killer (BIK).	[26]
Romidepsin	DMT5GNL	Approved	Romidepsin increases the expression of Bcl-2-interacting killer (BIK).	[34]
Chlorambucil	DMRKE63	Approved	Chlorambucil increases the expression of Bcl-2-interacting killer (BIK).	[40]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Bcl-2-interacting killer (BIK).	[41]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Bcl-2-interacting killer (BIK).	[42]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Bcl-2-interacting killer (BIK).	[43]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Bcl-2-interacting killer (BIK).	[40]
Duvelisib	DM7USVA	Phase 2 Trial	Duvelisib decreases the expression of Bcl-2-interacting killer (BIK).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Bcl-2-interacting killer (BIK).	[45]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Bcl-2-interacting killer (BIK).	[46]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 increases the expression of Bcl-2-interacting killer (BIK).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Bcl-2-interacting killer (BIK).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Bcl-2-interacting killer (BIK).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Bcl-2-interacting killer (BIK).	[50]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Bcl-2-interacting killer (BIK).	[51]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Bcl-2-interacting killer (BIK).	[52]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Bcl-2-interacting killer (BIK).	[17]

References

• [1] BAK, BAX, and NBK/BIK proapoptotic gene alterations in Iranian patients with ataxia telangiectasia.J Clin Immunol. 2010 Jan;30(1):132-7. doi: 10.1007/s10875-009-9340-6. Epub 2009 Nov 7.
• [2] Mutations of the BIK gene in human peripheral B-cell lymphomas.Genes Chromosomes Cancer. 2003 Sep;38(1):91-6. doi: 10.1002/gcc.10245.
• [3] Bcl2-interacting killer CpG methylation in multiple myeloma: a potential predictor of relapsed/refractory disease with therapeutic implications.Leuk Lymphoma. 2012 Sep;53(9):1709-13. doi: 10.3109/10428194.2012.661854. Epub 2012 Mar 13.
• [4] Breast cancer cell line MDA-MB-231 miRNA profile expression after BIK interference: BIK involvement in autophagy.Tumour Biol. 2016 May;37(5):6749-59. doi: 10.1007/s13277-015-4494-8. Epub 2015 Dec 10.
• [5] Low BIK outside-inside-out interactive inflammation immune-induced transcription-dependent apoptosis through FUT3-PMM2-SQSTM1-SFN-ZNF384.Immunol Res. 2016 Apr;64(2):461-9. doi: 10.1007/s12026-015-8701-x.
• [6] Loss of the tissue-specific proapoptotic BH3-only protein Nbk/Bik is a unifying feature of renal cell carcinoma.Cell Death Differ. 2006 Apr;13(4):619-27. doi: 10.1038/sj.cdd.4401782.
• [7] MicroRNA 486-3p directly targets BIK and regulates apoptosis and invasion in colorectal cancer cells.Onco Targets Ther. 2018 Dec 6;11:8791-8801. doi: 10.2147/OTT.S180354. eCollection 2018.
• [8] BIK (NBK) is a mediator of the sensitivity of Fanconi anaemia group C lymphoblastoid cell lines to interstrand DNA cross-linking agents.Biochem J. 2012 Nov 15;448(1):153-63. doi: 10.1042/BJ20120327.
• [9] Adenoviral natural born killer gene therapy for malignant glioma.Hum Gene Ther. 2003 Sep 1;14(13):1235-46. doi: 10.1089/104303403767740777.
• [10] Combination of lenalidomide with vitamin D3 induces apoptosis in mantle cell lymphoma via demethylation of BIK.Cell Death Dis. 2014 Aug 28;5(8):e1389. doi: 10.1038/cddis.2014.346.
• [11] Apoptosis-Related Gene Expression Profiling in Hematopoietic Cell Fractions of MDS Patients.PLoS One. 2016 Nov 30;11(11):e0165582. doi: 10.1371/journal.pone.0165582. eCollection 2016.
• [12] BIK, the founding member of the BH3-only family proteins: mechanisms of cell death and role in cancer and pathogenic processes.Oncogene. 2008 Dec;27 Suppl 1(Suppl 1):S20-9. doi: 10.1038/onc.2009.40.
• [13] Increase of zinc finger protein 179 in response to CCAAT/enhancer binding protein delta conferring an antiapoptotic effect in astrocytes of Alzheimer's disease.Mol Neurobiol. 2015 Feb;51(1):370-82. doi: 10.1007/s12035-014-8714-9. Epub 2014 May 1.
• [14] KLF4, a miR-32-5p targeted gene, promotes cisplatin-induced apoptosis by upregulating BIK expression in prostate cancer.Cell Commun Signal. 2018 Sep 3;16(1):53. doi: 10.1186/s12964-018-0270-x.
• [15] HDAC and Proteasome Inhibitors Synergize to Activate Pro-Apoptotic Factors in Synovial Sarcoma.PLoS One. 2017 Jan 5;12(1):e0169407. doi: 10.1371/journal.pone.0169407. eCollection 2017.
• [16] The Circulating GRP78/BiP Is a Marker of Metabolic Diseases and Atherosclerosis: Bringing Endoplasmic Reticulum Stress into the Clinical Scenario.J Clin Med. 2019 Oct 26;8(11):1793. doi: 10.3390/jcm8111793.
• [17] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
• [18] Apoptosis of pancreatic -cells in Type 1 diabetes.Bosn J Basic Med Sci. 2017 Aug 20;17(3):183-193. doi: 10.17305/bjbms.2017.1961.
• [19] BIK is involved in BRAF/MEK inhibitor induced apoptosis in melanoma cell lines.Cancer Lett. 2017 Sep 28;404:70-78. doi: 10.1016/j.canlet.2017.07.005. Epub 2017 Jul 15.
• [20] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [21] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [22] Neuronal and cardiac toxicity of pharmacological compounds identified through transcriptomic analysis of human pluripotent stem cell-derived embryoid bodies. Toxicol Appl Pharmacol. 2021 Dec 15;433:115792. doi: 10.1016/j.taap.2021.115792. Epub 2021 Nov 3.
• [23] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [24] Doxorubicin induces cell senescence preferentially over apoptosis in the FU-SY-1 synovial sarcoma cell line. J Orthop Res. 2006 Jun;24(6):1163-9. doi: 10.1002/jor.20169.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] Pharmacological inhibition of Rho-kinase (ROCK) signaling enhances cisplatin resistance in neuroblastoma cells. Int J Oncol. 2010 Nov;37(5):1297-305. doi: 10.3892/ijo_00000781.
• [27] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [28] Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
• [29] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [30] Improved apoptotic cell death in drug-resistant non-small-cell lung cancer cells by tumor necrosis factor-related apoptosis-inducing ligand-based treatment. J Pharmacol Exp Ther. 2014 Mar;348(3):360-71. doi: 10.1124/jpet.113.210054. Epub 2013 Dec 17.
• [31] Protective effects of hepatocyte growth factor gene overexpression against hydrogen peroxide-induced apoptosis in mesenchymal stem cells. Environ Toxicol. 2019 Nov;34(11):1236-1245. doi: 10.1002/tox.22824. Epub 2019 Jul 16.
• [32] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [33] A dual role of p21waf1/cip1 gene in apoptosis of HEp-2 treated with cisplatin or methotrexate. Cancer Gene Ther. 2008 Sep;15(9):576-90. doi: 10.1038/cgt.2008.28. Epub 2008 May 16.
• [34] 5-Aza-2'-deoxycytidine and depsipeptide synergistically induce expression of BIK (BCL2-interacting killer). Biochem Biophys Res Commun. 2006 Dec 15;351(2):455-61. doi: 10.1016/j.bbrc.2006.10.055. Epub 2006 Oct 18.
• [35] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [36] PS-341 (bortezomib) induces lysosomal cathepsin B release and a caspase-2-dependent mitochondrial permeabilization and apoptosis in human pancreatic cancer cells. J Biol Chem. 2006 Apr 28;281(17):11923-32. doi: 10.1074/jbc.M508533200. Epub 2006 Jan 30.
• [37] Clozapine induces oxidative stress and proapoptotic gene expression in neutrophils of schizophrenic patients. J Clin Psychopharmacol. 2005 Oct;25(5):419-26. doi: 10.1097/01.jcp.0000177668.42640.fe.
• [38] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [39] Comparative gene expression analysis of a chronic myelogenous leukemia cell line resistant to cyclophosphamide using oligonucleotide arrays and response to tyrosine kinase inhibitors. Leuk Res. 2007 Nov;31(11):1511-20.
• [40] Oxidative stress mechanisms do not discriminate between genotoxic and nongenotoxic liver carcinogens. Chem Res Toxicol. 2015 Aug 17;28(8):1636-46.
• [41] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [42] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [43] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [44] Duvelisib treatment is associated with altered expression of apoptotic regulators that helps in sensitization of chronic lymphocytic leukemia cells to venetoclax (ABT-199). Leukemia. 2017 Sep;31(9):1872-1881. doi: 10.1038/leu.2016.382. Epub 2016 Dec 26.
• [45] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [46] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [47] Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Expressomal approach for comprehensive analysis and visualization of ligand sensitivities of xenoestrogen responsive genes. Proc Natl Acad Sci U S A. 2013 Oct 8;110(41):16508-13. doi: 10.1073/pnas.1315929110. Epub 2013 Sep 23.
• [50] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [51] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [52] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [53] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
• [54] Caspase-independent induction of apoptosis in human melanoma cells by the proapoptotic Bcl-2-related protein Nbk / Bik. Oncogene. 2005 Nov 10;24(49):7369-80. doi: 10.1038/sj.onc.1208890.
• [55] Application of human haploid cell genetic screening model in identifying the genes required for resistance to environmental toxicants: Chlorpyrifos as a case study. J Pharmacol Toxicol Methods. 2015 Nov-Dec;76:76-82. doi: 10.1016/j.vascn.2015.08.154. Epub 2015 Aug 20.