Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUZYC61)

DOT Name C-C motif chemokine 27 (CCL27)
Synonyms CC chemokine ILC; Cutaneous T-cell-attracting chemokine; CTACK; ESkine; IL-11 R-alpha-locus chemokine; Skinkine; Small-inducible cytokine A27
Gene Name CCL27
Related Disease
Skin disease ( )
Actinic keratosis ( )
Ankylosing spondylitis ( )
Asthma ( )
Atopic dermatitis ( )
Breast lobular carcinoma ( )
Cardiovascular disease ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Dermatitis ( )
Hepatocellular carcinoma ( )
Hypercalcaemia ( )
IgA nephropathy ( )
Lung cancer ( )
Lung carcinoma ( )
Malignant mesothelioma ( )
Metabolic disorder ( )
Multiple sclerosis ( )
Neoplasm ( )
Non-alcoholic fatty liver disease ( )
Obesity ( )
Plasma cell myeloma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Pyropoikilocytosis, hereditary ( )
Renal cell carcinoma ( )
Rheumatoid arthritis ( )
Squamous cell carcinoma ( )
Toxic epidermal necrolysis ( )
Amyotrophic lateral sclerosis ( )
Hepatitis C virus infection ( )
Acute myelogenous leukaemia ( )
Alzheimer disease ( )
Advanced cancer ( )
Allergic contact dermatitis ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Contact dermatitis ( )
Familial hypocalciuric hypercalcemia 1 ( )
Granular corneal dystrophy type II ( )
Hypophosphatasia ( )
Melanoma ( )
Mycosis fungoides ( )
Osteoporosis ( )
Osteosarcoma ( )
UniProt ID
CCL27_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2KUM
Pfam ID
PF00048
Sequence
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Function Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
Tissue Specificity Testis, thymus, placenta, ovary and skin.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Viral protein interaction with cytokine and cytokine receptor (hsa04061 )
Chemokine sig.ling pathway (hsa04062 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Skin disease DISDW8R6 Definitive Biomarker [1]
Actinic keratosis DISR1RC5 Strong Biomarker [2]
Ankylosing spondylitis DISRC6IR Strong Altered Expression [3]
Asthma DISW9QNS Strong Biomarker [4]
Atopic dermatitis DISTCP41 Strong Biomarker [1]
Breast lobular carcinoma DISBY98Q Strong Genetic Variation [5]
Cardiovascular disease DIS2IQDX Strong Biomarker [6]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [7]
Colon cancer DISVC52G Strong Altered Expression [8]
Colon carcinoma DISJYKUO Strong Altered Expression [8]
Dermatitis DISY5SZC Strong Altered Expression [9]
Hepatocellular carcinoma DIS0J828 Strong Genetic Variation [10]
Hypercalcaemia DISKQ2K7 Strong Biomarker [11]
IgA nephropathy DISZ8MTK Strong Biomarker [12]
Lung cancer DISCM4YA Strong Biomarker [13]
Lung carcinoma DISTR26C Strong Biomarker [13]
Malignant mesothelioma DISTHJGH Strong Biomarker [14]
Metabolic disorder DIS71G5H Strong Biomarker [15]
Multiple sclerosis DISB2WZI Strong Biomarker [16]
Neoplasm DISZKGEW Strong Biomarker [17]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [18]
Obesity DIS47Y1K Strong Biomarker [19]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [20]
Prostate cancer DISF190Y Strong Biomarker [21]
Prostate carcinoma DISMJPLE Strong Biomarker [21]
Pyropoikilocytosis, hereditary DISZGN3B Strong Biomarker [22]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [7]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [23]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [24]
Toxic epidermal necrolysis DISIWPFR Strong Altered Expression [25]
Amyotrophic lateral sclerosis DISF7HVM moderate Biomarker [26]
Hepatitis C virus infection DISQ0M8R moderate Genetic Variation [27]
Acute myelogenous leukaemia DISCSPTN Disputed Genetic Variation [28]
Alzheimer disease DISF8S70 Disputed Biomarker [26]
Advanced cancer DISAT1Z9 Limited Biomarker [29]
Allergic contact dermatitis DISFFVF9 Limited Altered Expression [30]
Bone osteosarcoma DIST1004 Limited Biomarker [31]
Breast cancer DIS7DPX1 Limited Biomarker [32]
Breast carcinoma DIS2UE88 Limited Biomarker [32]
Contact dermatitis DISQ3AU0 Limited Biomarker [33]
Familial hypocalciuric hypercalcemia 1 DISPW6O5 Limited Genetic Variation [34]
Granular corneal dystrophy type II DISAEE20 Limited Biomarker [30]
Hypophosphatasia DISCQ0O2 Limited Biomarker [35]
Melanoma DIS1RRCY Limited Altered Expression [36]
Mycosis fungoides DIS62RB8 Limited Altered Expression [37]
Osteoporosis DISF2JE0 Limited Altered Expression [38]
Osteosarcoma DISLQ7E2 Limited Biomarker [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of C-C motif chemokine 27 (CCL27). [39]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the secretion of C-C motif chemokine 27 (CCL27). [40]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of C-C motif chemokine 27 (CCL27). [41]
------------------------------------------------------------------------------------

References

1 Ionizing radiation promotes CCL27 secretion from keratinocytes through the cross talk between TNF- and ROS.J Biochem Mol Toxicol. 2017 Mar;31(3). doi: 10.1002/jbt.21868. Epub 2016 Nov 23.
2 Peptidase inhibitor 3 and chemokine ligand 27 may serve as biomarkers for actinic keratoses in organ transplant recipients.Eur J Dermatol. 2019 Jun 1;29(3):259-267. doi: 10.1684/ejd.2019.3559.
3 Regulation of osteoblasts by alkaline phosphatase in ankylosing spondylitis.Int J Rheum Dis. 2019 Feb;22(2):252-261. doi: 10.1111/1756-185X.13419. Epub 2018 Nov 11.
4 Epithelial cell-derived cytokines: more than just signaling the alarm.J Clin Invest. 2019 Apr 1;129(4):1441-1451. doi: 10.1172/JCI124606. Epub 2019 Apr 1.
5 Tumor microenvironment in invasive lobular carcinoma: possible therapeutic targets.Breast Cancer Res Treat. 2016 Jan;155(1):65-75. doi: 10.1007/s10549-015-3668-9. Epub 2015 Dec 29.
6 Pharmacodynamic effects of Dan-hong injection in rats with blood stasis syndrome.Biomed Pharmacother. 2019 Oct;118:109187. doi: 10.1016/j.biopha.2019.109187. Epub 2019 Jul 11.
7 Reduced L/B/K alkaline phosphatase gene expression in renal cell carcinoma: plausible role in tumorigenesis.Biochimie. 2014 Sep;104:27-35. doi: 10.1016/j.biochi.2014.05.011. Epub 2014 Jun 5.
8 The intestinal epithelial cell differentiation marker intestinal alkaline phosphatase (ALPi) is selectively induced by histone deacetylase inhibitors (HDACi) in colon cancer cells in a Kruppel-like factor 5 (KLF5)-dependent manner.J Biol Chem. 2014 Sep 5;289(36):25306-16. doi: 10.1074/jbc.M114.557546. Epub 2014 Jul 18.
9 The Skin-Brain Connection Hypothesis, Bringing Together CCL27-Mediated T-Cell Activation in the Skin and Neural Cell Damage in the Adult Brain.Front Immunol. 2017 Jan 16;7:683. doi: 10.3389/fimmu.2016.00683. eCollection 2016.
10 Hypersplenism is correlated with increased risk of hepatocellular carcinoma in patients with post-hepatitis cirrhosis.Tumour Biol. 2016 Jul;37(7):8889-900. doi: 10.1007/s13277-015-4764-5. Epub 2016 Jan 11.
11 The chloride/phosphate ratio combined with alkaline phosphatase as a valuable predictive marker for primary hyperparathyroidism in Chinese individuals.Sci Rep. 2017 Jul 7;7(1):4868. doi: 10.1038/s41598-017-05183-6.
12 Tonsillitis exacerbates renal injury in IgA nephropathy through promoting Th22 cells chemotaxis.Int Urol Nephrol. 2018 Jul;50(7):1285-1292. doi: 10.1007/s11255-018-1792-2. Epub 2018 Mar 16.
13 Bone turnover markers and novel biomarkers in lung cancer bone metastases.Biomarkers. 2018 Sep;23(6):518-526. doi: 10.1080/1354750X.2018.1463566. Epub 2018 Apr 23.
14 Increased levels of C-C chemokine RANTES in asbestos exposed workers and in malignant mesothelioma patients from an hyperendemic area.PLoS One. 2014 Aug 27;9(8):e104848. doi: 10.1371/journal.pone.0104848. eCollection 2014.
15 Adipose Type One Innate Lymphoid Cells Regulate Macrophage Homeostasis through Targeted Cytotoxicity.Immunity. 2017 Feb 21;46(2):273-286. doi: 10.1016/j.immuni.2017.01.008.
16 Elevated Levels of Proinflammatory Cytokines in Cerebrospinal Fluid of Multiple Sclerosis Patients.Front Immunol. 2017 May 18;8:531. doi: 10.3389/fimmu.2017.00531. eCollection 2017.
17 Endometrial Tumor Microenvironment Alters Human NK Cell Recruitment, and Resident NK Cell Phenotype and Function.Front Immunol. 2019 Apr 26;10:877. doi: 10.3389/fimmu.2019.00877. eCollection 2019.
18 Chicory (Cichorium intybus L.) polysaccharides attenuate high-fat diet induced non-alcoholic fatty liver disease via AMPK activation.Int J Biol Macromol. 2018 Oct 15;118(Pt A):886-895. doi: 10.1016/j.ijbiomac.2018.06.140. Epub 2018 Jun 28.
19 Innate lymphoid cells at the interface between obesity and asthma.Immunology. 2018 Jan;153(1):21-30. doi: 10.1111/imm.12832. Epub 2017 Sep 26.
20 CCR10/CCL27 crosstalk contributes to failure of proteasome-inhibitors in multiple myeloma.Oncotarget. 2016 Nov 29;7(48):78605-78618. doi: 10.18632/oncotarget.12522.
21 Bufalin suppresses the migration and invasion of prostate cancer cells through HOTAIR, the sponge of miR-520b.Acta Pharmacol Sin. 2019 Sep;40(9):1228-1236. doi: 10.1038/s41401-019-0234-8. Epub 2019 Apr 26.
22 Tissue non-specific alkaline phosphatase activity and mineralization capacity of bi-allelic mutations from severe perinatal and asymptomatic hypophosphatasia phenotypes: Results from an in vitro mutagenesis model.Bone. 2019 Oct;127:9-16. doi: 10.1016/j.bone.2019.05.031. Epub 2019 May 27.
23 Rosmarinic acid exerts an antagonistic effect on vascular calcification by regulating the Nrf2 signalling pathway.Free Radic Res. 2019 Feb;53(2):187-197. doi: 10.1080/10715762.2018.1558447. Epub 2019 Mar 13.
24 Tumor immune escape by the loss of homeostatic chemokine expression.Proc Natl Acad Sci U S A. 2007 Nov 27;104(48):19055-60. doi: 10.1073/pnas.0705673104. Epub 2007 Nov 19.
25 Diverse expression of TNF- and CCL27 in serum and blister of Stevens-Johnson syndrome/toxic epidermal necrolysis.Clin Transl Allergy. 2018 Apr 20;8:12. doi: 10.1186/s13601-018-0199-6. eCollection 2018.
26 The cargo receptor SQSTM1 ameliorates neurofibrillary tangle pathology and spreading through selective targeting of pathological MAPT (microtubule associated protein tau).Autophagy. 2019 Apr;15(4):583-598. doi: 10.1080/15548627.2018.1532258. Epub 2018 Oct 16.
27 Effect of IL15 rs10833 and SCARB1 rs10846744 on virologic responses in chronic hepatitis C patients treated with pegylated interferon- and ribavirin.Gene. 2017 Sep 30;630:28-34. doi: 10.1016/j.gene.2017.08.005. Epub 2017 Aug 4.
28 A case of angioimmunoblastic T-cell non-Hodgkin lymphoma with a neocentric inv dup(1).Cancer Genet Cytogenet. 2010 Oct 1;202(1):38-42. doi: 10.1016/j.cancergencyto.2010.06.004.
29 CCL27/CCL28-CCR10 Chemokine Signaling Mediates Migration of Lymphatic Endothelial Cells.Cancer Res. 2019 Apr 1;79(7):1558-1572. doi: 10.1158/0008-5472.CAN-18-1858. Epub 2019 Feb 1.
30 Kinetics and differential expression of the skin-related chemokines CCL27 and CCL17 in psoriasis, atopic dermatitis and allergic contact dermatitis.Exp Dermatol. 2011 Oct;20(10):789-94. doi: 10.1111/j.1600-0625.2011.01323.x. Epub 2011 Jun 24.
31 Lung cells support osteosarcoma cell migration and survival.BMC Cancer. 2017 Jan 25;17(1):78. doi: 10.1186/s12885-017-3047-5.
32 Three gold indicators for breast cancer prognosis: a case-control study with ROC analysis for novel ratios related to CBC with (ALP and LDH).Mol Biol Rep. 2019 Apr;46(2):2013-2027. doi: 10.1007/s11033-019-04650-9. Epub 2019 Jan 31.
33 Genes specifically modulated in sensitized skins allow the detection of sensitizers in a reconstructed human skin modelDevelopment of the SENS-IS assay. Toxicol In Vitro. 2015 Jun;29(4):787-802.
34 Association between iron overload and osteoporosis in patients with hereditary hemochromatosis.Osteoporos Int. 2009 Apr;20(4):549-55. doi: 10.1007/s00198-008-0701-4. Epub 2008 Jul 26.
35 HYPOPHOSPHATASIA: CLINICAL ASSESSMENT AND MANAGEMENT IN THE ADULT PATIENT-A NARRATIVE REVIEW.Endocr Pract. 2018 Dec;24(12):1086-1092. doi: 10.4158/EP-2018-0194. Epub 2018 Oct 5.
36 High CCL27 immunoreactivity in 'supratumoral' epidermis correlates with better prognosis in patients with cutaneous malignant melanoma.J Clin Pathol. 2017 Jan;70(1):15-19. doi: 10.1136/jclinpath-2015-203537. Epub 2016 Jun 20.
37 Microarray analysis of gene expression by microdissected epidermis and dermis in mycosis fungoides and adult T-cell leukemia/lymphoma.Int J Oncol. 2014 Sep;45(3):1200-8. doi: 10.3892/ijo.2014.2524. Epub 2014 Jun 26.
38 LncRNA NEAT1/miR-29b-3p/BMP1 axis promotes osteogenic differentiation in human bone marrow-derived mesenchymal stem cells.Pathol Res Pract. 2019 Mar;215(3):525-531. doi: 10.1016/j.prp.2018.12.034. Epub 2018 Dec 31.
39 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
40 Induction of cytokine (interleukin-1alpha and tumor necrosis factor-alpha) and chemokine (CCL20, CCL27, and CXCL8) alarm signals after allergen and irritant exposure. Exp Dermatol. 2005 Feb;14(2):109-16. doi: 10.1111/j.0906-6705.2005.00226.x.
41 Gene expression changes associated with altered growth and differentiation in benzo[a]pyrene or arsenic exposed normal human epidermal keratinocytes. J Appl Toxicol. 2008 May;28(4):491-508.